Gene Information

Name : Celgi_0652 (Celgi_0652)
Accession : YP_004599739.1
Strain : Cellvibrio gilvus ATCC 13127
Genome accession: NC_015671
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 714949 - 715527 bp
Length : 579 bp
Strand : -
Note : PFAM: stress protein; KEGG: tcu:Tcur_3799 stress protein

DNA sequence :
ATGAGCATCTCCCTCGCCAAGGGCGGCAACGTCTCGCTCAGCAAGGAGGCCCCGAACCTCACGGCCGTCACGGTCGGCCT
GGGCTGGGACGTCCGCACGACGAGCGGGACGGACTTCGACCTCGACGCCTCGGCGCTGCTGCTGGGTGCCGAGGGCAAGG
TCCTGTCCGACCAGCACTTCATCTTCTACAACAACCTGACCTCGCCCGACGGCACCGTCGAGCACACGGGCGACAACCGC
ACGGGTGAGGGCGACGGCGACGACGAGTCGGTCAACGTCGACCTCGCGCGGCTCGCGCCCGAGGTGCAGCGGATCGTCTT
CCCGGTCTCGATCCACGACGCCGCGGCGCGCTCGCAGAACTTCGGGCAGGTGCGCAACGCGTTCATCCGCGTGGTGAACC
GTGCGGACGGCCAGGAGCTGGCCCGCTACGACCTCACGGAGGACGCGTCCTCGGAGACCGCCATGGTCTTCGGCGAGGTG
TACCGCCACGGTGCGGAGTGGAAGTTCCGCGCGGTCGGCCAGGGGTACGAGTCGGGGCTCCTGGGCATCGCCCGGGACTT
CGGCGTCAACGTCGGCTGA

Protein sequence :
MSISLAKGGNVSLSKEAPNLTAVTVGLGWDVRTTSGTDFDLDASALLLGAEGKVLSDQHFIFYNNLTSPDGTVEHTGDNR
TGEGDGDDESVNVDLARLAPEVQRIVFPVSIHDAAARSQNFGQVRNAFIRVVNRADGQELARYDLTEDASSETAMVFGEV
YRHGAEWKFRAVGQGYESGLLGIARDFGVNVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-60 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-61 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-61 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-62 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-60 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-60 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-60 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-32 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celgi_0652 YP_004599739.1 stress protein BAC0389 Protein 1e-59 65
Celgi_0652 YP_004599739.1 stress protein BAC0390 Protein 3e-63 64
Celgi_0652 YP_004599739.1 stress protein BAC0392 Protein 3e-27 41