Gene Information

Name : EAE_02715 (EAE_02715)
Accession : YP_004590757.1
Strain : Enterobacter aerogenes KCTC 2190
Genome accession: NC_015663
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 570501 - 570707 bp
Length : 207 bp
Strand : +
Note : COG3311 Predicted transcriptional regulator

DNA sequence :
ATGACCACAGATTACAGCGTTCTTAAAGACCAACTGGTAACGATGGCGTTTATCACCCAGCTTACCGGCTTAACCGACAA
ATGGTTCTATAAGCTCATACAGGACGGTGAGTTCCCGAAGCCCATTAAGCTGGGCAGGAGCTCCCGCTGGCTTGAAAGCG
AAGTGGAAGCCTGGCTGCAGCAACGCATCGCGCACTCCCGGCAATAG

Protein sequence :
MTTDYSVLKDQLVTMAFITQLTGLTDKWFYKLIQDGEFPKPIKLGRSSRWLESEVEAWLQQRIAHSRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 2e-21 80
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 4e-21 78
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 4e-21 77
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 4e-21 77
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 9e-21 75
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-20 75
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-20 75
unnamed AAL08466.1 unknown Not tested SRL Protein 6e-21 75
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 1e-17 71
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-17 71
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 4e-14 70
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 4e-14 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAE_02715 YP_004590757.1 phage transcriptional regulator AlpA VFG0651 Protein 3e-21 75
EAE_02715 YP_004590757.1 phage transcriptional regulator AlpA VFG1057 Protein 2e-21 75
EAE_02715 YP_004590757.1 phage transcriptional regulator AlpA VFG1480 Protein 6e-18 71