Gene Information

Name : EAE_13620 (EAE_13620)
Accession : YP_004592917.1
Strain : Enterobacter aerogenes KCTC 2190
Genome accession: NC_015663
Putative virulence/resistance : Virulence
Product : iron-enterobactin transporter ATP-binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1120
EC number : -
Position : 2931325 - 2932119 bp
Length : 795 bp
Strand : -
Note : COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components

DNA sequence : 
ATGACCGCTGTAACTTCCCGTTTGCGCGGCGACCAGTTGACCCTGGCCTACGGCAAAAAGACCATCGCCGAATCGCTGAA
CGTCACGATTCCTGACGGCCATTTCACGGCGATTATCGGCCCCAACGGCTGTGGTAAATCAACCCTGCTTCGCACCCTCA
GCCGCCTGATGACCCCGTCCAGCGGCCACGTTTATCTCGATGGCGAGCAGATCCAGCACTACGCCAGCAAAGAGGTGGCA
AAGCGGATTGGCCTGCTGGCGCAGAATGCCACCACGCCCGGCGATATCACCGTACAGGAACTGGTGGCGCGCGGGCGCTA
TCCGCACCAGCCGATGTTTACCCGTTGGCGTAAAGAAGACGAAGCAGCGGTAAATAACGCGATGCGGGCGACGGGGATTG
TCGACCTCGCGCTGCAGAGCGTGGATACCCTCTCCGGCGGCCAGCGCCAGCGGGCGTGGATTGCGATGGTACTGGCGCAG
GAGACGGCGATTATGCTGCTTGATGAGCCGACGACCTGGCTGGATATCAGCCATCAGATCGACCTGCTGGAACTGTTAAG
CGAGCTGAATCGCGAGAAGGGATATACGCTGGCGGCGGTACTGCACGATCTCAATCAGGCCTGTCGTTACGCCACCCATC
TGATCGCCCTGCGCGACGGTAAGATCGTTGCCGAAGGCGCGCCGAAAGAGATCGTCACGGCGGATCTAATTGAGCGTATC
TACGGTCTGCGCTGCACGATCATCGACGATCCGGTGGCGCATACGCCGCTGGTAGTGCCGCTGGGTCGCCGATAA

Protein sequence : 
MTAVTSRLRGDQLTLAYGKKTIAESLNVTIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPSSGHVYLDGEQIQHYASKEVA
KRIGLLAQNATTPGDITVQELVARGRYPHQPMFTRWRKEDEAAVNNAMRATGIVDLALQSVDTLSGGQRQRAWIAMVLAQ
ETAIMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYATHLIALRDGKIVAEGAPKEIVTADLIERI
YGLRCTIIDDPVAHTPLVVPLGRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 3e-57 50
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 3e-59 50
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 4e-59 50
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 4e-59 50
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 3e-59 50
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 3e-49 48
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 1e-55 48
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 1e-55 48
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-45 41
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-45 41
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-45 41
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-45 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAE_13620 YP_004592917.1 iron-enterobactin transporter ATP-binding protein BAC0164 Protein 2e-49 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAE_13620 YP_004592917.1 iron-enterobactin transporter ATP-binding protein VFG0925 Protein 7e-106 89
EAE_13620 YP_004592917.1 iron-enterobactin transporter ATP-binding protein VFG1042 Protein 2e-49 48