Gene Information

Name : EAE_06625 (EAE_06625)
Accession : YP_004591528.1
Strain : Enterobacter aerogenes KCTC 2190
Genome accession: NC_015663
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 1377878 - 1378348 bp
Length : 471 bp
Strand : +
Note : COG2003 DNA repair proteins

DNA sequence :
ATGTCTGCGCCCAATTTATTCCCGGAATTTCCTGTAAACGAGCAACGTGTTATACAACGCGCACTGCGATTGCTGGAGAA
GTATCAGCGTCAACCCAGTGAATCATTTACTAGCACCAGCGTTACTAAAGCCTGGCTTCAACTCAGGATGGCACACCTTG
AGCGTGAAGCTTTCATCGTGATGTATCTCGACAATCAGCACTGTTTGCTGGAACGCGAAACACTGTTTACCGGCACACTG
AGCCATACCGAGGTACATCCCCGCGAAGTGGTGAAATCGGCACTGAAGCATAATGCTGCTGCGGTAATTCTGGCGCACAA
CCATCCTTCTGGTACGACAGAAATCAGCCAGCAAGATAAACACATTACTCAGCGGATCGTGAAAGCGCTGGCGCTGGTGG
AAGTACGCGTGCTGGATCATCTCGTAGTCGGGAATGAGACAATTTCATTTGCTGAGCTGGGATTACTTTAA

Protein sequence :
MSAPNLFPEFPVNEQRVIQRALRLLEKYQRQPSESFTSTSVTKAWLQLRMAHLEREAFIVMYLDNQHCLLERETLFTGTL
SHTEVHPREVVKSALKHNAAAVILAHNHPSGTTEISQQDKHITQRIVKALALVEVRVLDHLVVGNETISFAELGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 1e-34 59
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 7e-36 58
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 1e-35 58
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 7e-36 58
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 1e-35 58
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 1e-35 58
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 3e-35 58
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 7e-35 58
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 7e-35 58
unnamed AAL08475.1 unknown Not tested SRL Protein 6e-35 58
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 3e-35 57
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 1e-34 57
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 57
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 4e-35 57
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-35 57
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 3e-35 57
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 3e-35 57
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 3e-35 57
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 2e-34 56
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-27 53
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-27 53
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 4e-27 53
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 4e-23 49
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 6e-22 43
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 1e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAE_06625 YP_004591528.1 hypothetical protein VFG1678 Protein 3e-36 58
EAE_06625 YP_004591528.1 hypothetical protein VFG0660 Protein 2e-35 58
EAE_06625 YP_004591528.1 hypothetical protein VFG1066 Protein 3e-35 58
EAE_06625 YP_004591528.1 hypothetical protein VFG1617 Protein 6e-35 57
EAE_06625 YP_004591528.1 hypothetical protein VFG1528 Protein 1e-35 57
EAE_06625 YP_004591528.1 hypothetical protein VFG1119 Protein 2e-27 53