Gene Information

Name : Geoth_0905 (Geoth_0905)
Accession : YP_004586984.1
Strain : Geobacillus thermoglucosidasius C56-YS93
Genome accession: NC_015660
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 880416 - 881123 bp
Length : 708 bp
Strand : +
Note : KEGG: gmc:GY4MC1_0836 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver

DNA sequence :
ATGAGCAAAAAAGTATTAGTTGTTGATGATGAGCAATCGATTGTCACACTTTTAACATACAATTTGGAACGTGCAGGATT
TACGGTCGTAACCGCAAACGACGGTGAGGAAGCGATCGAAAAGGTGGCGGCCGAACGGCCGGAGTTTATTATTCTTGATT
TAATGCTGCCAAAGCTCGATGGAGTGGAAGTATGCAAACAATTGCGCCAGCAGAAAGTGATGACACCGATTTTAATGTTG
ACAGCGAAAGATGATGAATTTGATAAAATACTTGGACTTGAACTCGGTGCGGATGATTATATGACGAAGCCGTTCAGCCC
CCGCGAAGTAGTAGCGCGGGTTAAAGCGATTTTGCGGCGCACGCAGTTTTCTAACGGAGAAACGGAAGCGATAGATAAAA
TTGTCATCGGCGATTTAAAAATTTTTCCTGATCAATATGAAGCGTATTTTGGCGGAGAGCGGCTTGAGCTGACGCCAAAA
GAATTTGAGCTGCTTCTTTATTTAGCGAAACATAAAGGCCGGGTGTTAACGAGAGACCAGCTGTTAAGCGCGGTATGGAA
TTACGATTTTGCCGGAGATACCCGCATTGTTGACGTTCACATCAGCCATTTGCGTGAAAAAATTGAACAGGATACGAAAA
AACCTTTATATATTAAAACAATACGAGGACTTGGGTATAAGCTAGAGGAGCCGAAGCGGAATGACTAG

Protein sequence :
MSKKVLVVDDEQSIVTLLTYNLERAGFTVVTANDGEEAIEKVAAERPEFIILDLMLPKLDGVEVCKQLRQQKVMTPILML
TAKDDEFDKILGLELGADDYMTKPFSPREVVARVKAILRRTQFSNGETEAIDKIVIGDLKIFPDQYEAYFGGERLELTPK
EFELLLYLAKHKGRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLREKIEQDTKKPLYIKTIRGLGYKLEEPKRND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-78 70
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-75 68
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-66 57
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-55 56
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 8e-64 55
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-38 44
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 7e-38 44
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 5e-41 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-41 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-41 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-42 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 8e-43 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-36 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-32 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-39 43
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-37 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 6e-41 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-30 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 1e-36 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-36 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator BAC0533 Protein 1e-36 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-36 42
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 4e-36 41
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator BAC0083 Protein 8e-34 41
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-41 41
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-35 45
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-42 44
Geoth_0905 YP_004586984.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-39 42