Gene Information

Name : FsymDg_4066 (FsymDg_4066)
Accession : YP_004585259.1
Strain : Frankia sp. 4085684
Genome accession: NC_015656
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4769721 - 4770401 bp
Length : 681 bp
Strand : -
Note : KEGG: fri:FraEuI1c_6323 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receive

DNA sequence :
GTGACCCGCCTGCTGGTCGTGGAGGACGAGGAGTCGTTCTCGGACGCGTTGTCGTTCATGCTGGAACGGGAGGGTTTCGA
CGTCGCGGTGGCCGCCGACGGGCTGGCCGCGCTGACCGAGTTCGAGCGGCACGGCGCCGATCTCGTCCTGTTGGACCTGA
TGCTGCCGGGCCTGTCCGGTACGGAGGTCTGCCGGGCGCTGCGGCAGCGGTCGACCGTCCCGGTGATCATGTTAACAGCC
CGCGACAGCGAGATAGACAAGGTCGTCGGCCTGGAACTCGGCGCGGACGACTACGTCACCAAGCCGTTCTCCGCCCGTGA
GCTGGTCGCCCGTATCCGCGCGGTGCTGCGCCGCCGCGGTGAGATCGACGAACGCGTCACGGCGACGCTGGAGGCCGGTC
CGGTGCGGATGGACGTCGAACGCCATGTCGTCACGGTCGCCGGCGCCTCCGTCCCACTGCCGCTGAAGGAGTTCGAGCTG
CTGGAGATGTTCCTGCGCAACGCCGGCCGGGTCCTCACCCGCGGTCAGCTGATCGACCGCGTCTGGGGGTCGGACTACGT
CGGGGACACCAAGACCCTCGACGTCCACGTCAAGCGTCTGCGTACCAAGATCGAGGGCGAGCCCGGGAACCCGCGCCACC
TGGTGACCGTCCGGGGTCTGGGGTACAAGTTCGAGCCCTGA

Protein sequence :
MTRLLVVEDEESFSDALSFMLEREGFDVAVAADGLAALTEFERHGADLVLLDLMLPGLSGTEVCRALRQRSTVPVIMLTA
RDSEIDKVVGLELGADDYVTKPFSARELVARIRAVLRRRGEIDERVTATLEAGPVRMDVERHVVTVAGASVPLPLKEFEL
LEMFLRNAGRVLTRGQLIDRVWGSDYVGDTKTLDVHVKRLRTKIEGEPGNPRHLVTVRGLGYKFEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-29 49
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-28 46
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-29 45
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-31 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-29 44
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-22 43
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-22 43
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-31 42
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-21 42
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-18 42
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-22 42
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-22 41
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-21 43
FsymDg_4066 YP_004585259.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-19 42