Gene Information

Name : FsymDg_3813 (FsymDg_3813)
Accession : YP_004585011.1
Strain : Frankia sp. 4085684
Genome accession: NC_015656
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4476369 - 4476944 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein; KEGG: fra:Francci3_3677 stress protein

DNA sequence :
GTGGGAGTCAGCCTCAGTAAGGGCGGAAACGTTTCGCTGACCAAGGAGGCACCCGGTCTGACCAACATCGTCGTCGGTCT
CGGCTGGGATGTCCGCAGCACGACCGGCGCTGATTTCGATCTTGACGCGAGCGCGATTGCCCTCAGATCCGATGGCAAGG
TCCTCTCGGACAGCCACTTCGTCTTCTTCAACAATCTCAAGAGCCCGGACGGCGCCATCGAGCATCAGGGCGACAACCTC
ACCGGTGAGGGAGAAGGTGACGATGAAGCGATCAACGTGAGCCTCGCCAGTCTGCCCGCGGAGGTCGACAAGGTGGTGTT
TCCGGTTTCGATCTATGACGCGGATGCACGCCAGCAGAACTTCGGTCAGGTCCGCAATGCGTTCATCAGGATCGTGAACG
GGGTGGGGGGCGCCGAGATCGCGCGTTACGATCTCACCGAGGACGCCTCCACCGAAACTGCGATGGTCTTCGGTGAAGTG
TACCGGCACGGCGCCGAGTGGAAGTTCCGGGCTGTCGGCCAGGGTTATGCGTCCGGGCTTGCCGGAATCGCCCGGGACTA
CGGAGTCAATGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTNIVVGLGWDVRSTTGADFDLDASAIALRSDGKVLSDSHFVFFNNLKSPDGAIEHQGDNL
TGEGEGDDEAINVSLASLPAEVDKVVFPVSIYDADARQQNFGQVRNAFIRIVNGVGGAEIARYDLTEDASTETAMVFGEV
YRHGAEWKFRAVGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-60 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-60 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-61 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-60 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-56 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-31 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-27 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_3813 YP_004585011.1 stress protein BAC0390 Protein 4e-60 65
FsymDg_3813 YP_004585011.1 stress protein BAC0389 Protein 9e-60 64
FsymDg_3813 YP_004585011.1 stress protein BAC0392 Protein 4e-27 41