Gene Information

Name : FsymDg_3491 (FsymDg_3491)
Accession : YP_004584701.1
Strain : Frankia sp. 4085684
Genome accession: NC_015656
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4119705 - 4120394 bp
Length : 690 bp
Strand : +
Note : KEGG: fri:FraEuI1c_3975 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receive

DNA sequence :
ATGCGGGTGCTGGTGGTCGAGGACGAAACACGCACCGCCACATTGCTGCGCCGCGGCCTGACCGAGGAAGGGTTCGCCGT
CGACATCGTCGCGGACGGCCTCGAGGCGGTATGGCAGGCCAGCGAAATCGCCTACGACGTCATCGTTCTCGACCTCATGC
TGCCGGGCCTCGACGGATTCGAGGTCTGCCGGCGCCTGCGCGCCGCCGGGCGCTGGGCACCGGTACTGATGCTCTCGGCC
CGCAGCGAGGTCACCGACCGCGTGCGCGGACTCGACGTCGGCGCCGACGACTACCTCGCCAAACCATTCAGCTTCGACGA
ACTGTTCGCCCGGATCCGGGCGCTTATCCGCCGCGGAACCCATGAACGCCCCGTCGTCCTCGACGTCGACGGGCTGCGAC
TTGACCCGGCCGGCCGCACCGCGAGCCGTGACGGCACCGCCCTCGACCTTTCACCCAAAGAATTCGCCCTCCTCGAATAC
CTGATGCGCCACCCCGGCGAGGTCCTCAGCCGAACAGCCATCCTCGAACACGTCTGGGACTTCGCCTACGACGGAACCTC
GAACGTGGTCGACCAGTACATCGCCTACCTTCGCCGCAAAATCGACAGGCCCTTCGGAATCTCACAACTGGAAACAGTCC
GCGGAGCCGGTTATCGGCTATGCGCCACCACGAGCACACGGACGGCCTGA

Protein sequence :
MRVLVVEDETRTATLLRRGLTEEGFAVDIVADGLEAVWQASEIAYDVIVLDLMLPGLDGFEVCRRLRAAGRWAPVLMLSA
RSEVTDRVRGLDVGADDYLAKPFSFDELFARIRALIRRGTHERPVVLDVDGLRLDPAGRTASRDGTALDLSPKEFALLEY
LMRHPGEVLSRTAILEHVWDFAYDGTSNVVDQYIAYLRRKIDRPFGISQLETVRGAGYRLCATTSTRTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-37 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 46
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-32 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-46 52
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-41 51
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-41 50
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-36 47
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-43 46
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 1e-29 45
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-38 45
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-38 45
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 7e-25 43
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-33 43
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 3e-23 42
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-31 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-37 47
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-37 47
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-42 45
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-39 44
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-32 41
FsymDg_3491 YP_004584701.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-32 41