Gene Information

Name : FsymDg_0299 (FsymDg_0299)
Accession : YP_004581792.1
Strain : Frankia sp. 4085684
Genome accession: NC_015656
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 360995 - 361867 bp
Length : 873 bp
Strand : +
Note : KEGG: fra:Francci3_0978 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
GTGGATCCGCCGCTGCTGGAAGAGCGCCGGATCCACATCCCTTCCCTGGCTCCTCGGTCCGCCATCCTCGGACGGTCGCC
TGAAGGATTACGAAATGGAGAAGCTGCTCTTCAAGCTTGTCGCAACCGGTTGTCAGGCCCTTATCGTGACGGCGTGACCC
GTGTCCTCGTCGTCGACGACGACCCGACCGTGGCCGAGGTCGTCGACCGGTATCTGCGTAACGCGGGCTTCGACGTCGAC
CGCGCCGCGGACGGCCTCACGGCGTTACGGATGGCCGAGACCACCGTGCCGGATCTTGTCGTGCTCGACCTGATGCTCCC
GGGCATCGACGGCATCGAAGTCTGCCGCCGGCTGCGGGAACAGCGGCCGGTACCGGTGATCATGTTGACCGCGCGGGGCG
AGGAGGCGGACCGTGTCGCAGGCCTCGAGACGGGCGCTGACGACTACGTGACCAAACCGTTCTCGCCGCGTGAGCTGACG
TTGCGGGTGCGGTCCGTGCTGCGAAGGGCGGCCGAGCCGCCGCGGGCATCCGGTGCGCTGCATGCCGGCATGCTGGTCGT
GGACGCGGCCGCCCGTACCGTCACCCGGCACGGGGTGGCGCTTTCCCTCACGGTGCGTGAGTTCGATCTGCTGGCTTTTC
TGCTGCGCCATCCCGGCCGTGCCTTCACCCGCTCCGAGCTGCTGGAACAGGTATGGGGATGGAGCTACGGCGACCCCTCG
ACGGTCACCGTCCACATCCGCCGGCTGCGGGAGAAGATCGAGGACGATCCGACCGCCCCTCGGATGCTCGTCACCGTGTG
GGGCGTCGGCTACCGGTACGACCAGACGCCACCGAGGCATACCGATGACGCATCTGTCGTCTACGAAACATAA

Protein sequence :
MDPPLLEERRIHIPSLAPRSAILGRSPEGLRNGEAALQACRNRLSGPYRDGVTRVLVVDDDPTVAEVVDRYLRNAGFDVD
RAADGLTALRMAETTVPDLVVLDLMLPGIDGIEVCRRLREQRPVPVIMLTARGEEADRVAGLETGADDYVTKPFSPRELT
LRVRSVLRRAAEPPRASGALHAGMLVVDAAARTVTRHGVALSLTVREFDLLAFLLRHPGRAFTRSELLEQVWGWSYGDPS
TVTVHIRRLREKIEDDPTAPRMLVTVWGVGYRYDQTPPRHTDDASVVYET

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-26 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-38 51
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-32 46
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-38 45
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-32 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-38 44
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-30 43
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 8e-39 43
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-39 43
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-22 43
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 6e-39 43
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-34 42
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-30 46
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-33 45
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-26 42
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-36 42
FsymDg_0299 YP_004581792.1 winged helix family two component transcriptional regulator VFG1702 Protein 8e-36 42