Gene Information

Name : MLP_12950 (MLP_12950)
Accession : YP_004571712.1
Strain : Microlunatus phosphovorus NM-1
Genome accession: NC_015635
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1416324 - 1416983 bp
Length : 660 bp
Strand : -
Note : -

DNA sequence : 
ATGGCTGCCATCTTGATCGCCGAGGACGAACCGCGGATCGCCGCCTTCGTCCAGAAAGGGCTCCGGGCGGCCGGTCTGTC
CACCACCATTGCGCGAACCGGACCGGAGGCTCTGGACTATGCCTGCAGCGGCGAGTTCGATCTGATGGTGCTGGACATCG
GTCTCCCCCAGCTGGACGGCTTCGCGGTGCTGGAGGCGTTGCGCGGACAGGGATCGACCCTGCCGGTCATCATCTTGACC
GCACGAGACTCCGTCACCGATACCGTCGCTGGGCTGGAGGGCGGCGCGGACGACTACATGGCCAAGCCGTTCCGTTTCGA
AGAGCTGCTGGCGAGGGTACGGATCCGGCTGCGGGACCAGCCGCAGGCGCAGGCGGTGGTCGTCACGCAGGGCGATCTCA
GCTTGGACCTGCGTACCCGAATCGTCTCGGTCAGCGGCAAGCCGGTCGAGCTCTCCGCCCGGGAGTTCACGCTGCTGGAG
ACCTTCCTGCGCCATCCCAACCAAGTGCTCAGCCGCGAACAGCTGCTGTCCCGGGTCTGGGGCTACGACTTCGACCCCGG
CTCGAACGTGGTCGACGTCTACGTGCGCTATCTGCGCAACAAGATCGGCAGCGACCGGATCGTCACGGTCCGCGGCGCCG
GCTACCGGCTGTCGGTCTGA

Protein sequence : 
MAAILIAEDEPRIAAFVQKGLRAAGLSTTIARTGPEALDYACSGEFDLMVLDIGLPQLDGFAVLEALRGQGSTLPVIILT
ARDSVTDTVAGLEGGADDYMAKPFRFEELLARVRIRLRDQPQAQAVVVTQGDLSLDLRTRIVSVSGKPVELSAREFTLLE
TFLRHPNQVLSREQLLSRVWGYDFDPGSNVVDVYVRYLRNKIGSDRIVTVRGAGYRLSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-36 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MLP_12950 YP_004571712.1 two-component system response regulator BAC0083 Protein 2e-40 46
MLP_12950 YP_004571712.1 two-component system response regulator BAC0308 Protein 7e-41 45
MLP_12950 YP_004571712.1 two-component system response regulator BAC0197 Protein 1e-37 45
MLP_12950 YP_004571712.1 two-component system response regulator BAC0638 Protein 3e-35 45
MLP_12950 YP_004571712.1 two-component system response regulator HE999704.1.gene1528. Protein 9e-33 44
MLP_12950 YP_004571712.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-32 43
MLP_12950 YP_004571712.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-36 43
MLP_12950 YP_004571712.1 two-component system response regulator BAC0111 Protein 6e-40 43
MLP_12950 YP_004571712.1 two-component system response regulator BAC0125 Protein 1e-38 43
MLP_12950 YP_004571712.1 two-component system response regulator BAC0347 Protein 2e-35 42
MLP_12950 YP_004571712.1 two-component system response regulator NC_002516.2.879194.p Protein 6e-26 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MLP_12950 YP_004571712.1 two-component system response regulator VFG1389 Protein 5e-38 46
MLP_12950 YP_004571712.1 two-component system response regulator VFG0596 Protein 9e-37 45
MLP_12950 YP_004571712.1 two-component system response regulator VFG1390 Protein 3e-39 44
MLP_12950 YP_004571712.1 two-component system response regulator VFG1386 Protein 3e-36 43