Gene Information

Name : VAA_04030 (VAA_04030)
Accession : YP_004567243.1
Strain :
Genome accession: NC_015633
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2832028 - 2832372 bp
Length : 345 bp
Strand : +
Note : -

DNA sequence :
GTGATATCATCACCTCATAAGTTAACAGGTGACACTATGACAAAACGTACAAGACGACTATTTAGCGCAGAATTTAAGTT
AGAAGCAGCACAGTTAGTCCTAGACCAAAACTACTCAGTAACTGAAGCGGCCCAAGCCATGAATGTGGGGAAATCCACGA
TGGATAAATGGGTTCGCCAGCTTAGAGAAGAACGCCAAGGGAAAACACCGAAAGCTTCACCTATGACCCCTGAACAAATA
GAAATTCGGGAATTAAAAAAGAAGCTGGCTCGCCTTGAAGAGCATAATGAAATATTAAAAAAAGCCACGGCTCTGTTGAT
GTCGGACTCACTGAACAATTCTTGA

Protein sequence :
MISSPHKLTGDTMTKRTRRLFSAEFKLEAAQLVLDQNYSVTEAAQAMNVGKSTMDKWVRQLREERQGKTPKASPMTPEQI
EIRELKKKLARLEEHNEILKKATALLMSDSLNNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-48 99
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-48 99
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-48 99
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-48 99
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-48 99
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-48 99
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-48 99
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-48 99
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 5e-31 77
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-31 77
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-31 77
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-27 75
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-26 69
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-31 64
unnamed AAC31483.1 L0004 Not tested LEE Protein 8e-31 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-31 64
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-30 64
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-30 64
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-27 64
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-22 56
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 45
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-18 44
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-18 43
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 8e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VAA_04030 YP_004567243.1 transposase VFG1123 Protein 2e-48 99
VAA_04030 YP_004567243.1 transposase VFG1485 Protein 8e-32 77
VAA_04030 YP_004567243.1 transposase VFG1553 Protein 2e-26 69
VAA_04030 YP_004567243.1 transposase VFG0784 Protein 3e-31 64
VAA_04030 YP_004567243.1 transposase VFG1566 Protein 9e-14 45
VAA_04030 YP_004567243.1 transposase VFG1521 Protein 3e-12 41