Gene Information

Name : Sinme_6679 (Sinme_6679)
Accession : YP_004557808.1
Strain :
Genome accession: NC_015597
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 65325 - 65672 bp
Length : 348 bp
Strand : +
Note : KEGG: rva:Rvan_3151 IS66 Orf2 family protein; manually curated; PFAM: Transposase (putative), IS66 Orf2-like

DNA sequence :
ATGATCCCTTTTGATAGTGGGGTTAAGGTGTGGCTTGCGACGGGCCATACGGATATGCGGCGCGGCTTCCCTGGCCTTGC
ACTACAGGTCCAGGAGATTTTGAAACAAGATCCATTCTGTGGGCATCTGTTTTGCTTTCGAGGCCGGAGAAGCAATCATT
TGAAAGTGATCTGGCACGACGGCCAGGGCAGTTGCACGTTCACAAAAAAGCTCGAGCGCGGGCGGTTCATCTGGCCTAAT
GTTGAGGGCGGAGCAGTGATGATCTCGTCTGCGCAGCTCTCCTATCTTTTGTCTGGAATAGACTGGCGAAACCCGCAACA
GACATGGCGTCCGACGAGCGCCGGATAG

Protein sequence :
MIPFDSGVKVWLATGHTDMRRGFPGLALQVQEILKQDPFCGHLFCFRGRRSNHLKVIWHDGQGSCTFTKKLERGRFIWPN
VEGGAVMISSAQLSYLLSGIDWRNPQQTWRPTSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-31 57
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-31 57
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-30 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-28 56
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-28 56
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-28 56
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-28 56
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-28 56
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-28 56
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-28 56
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-28 56
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-28 56
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-28 56
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-27 55
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-28 55
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-27 55
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-21 54
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-26 52
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-26 52
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-29 52
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-29 52
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-24 51
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-27 51
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-27 51
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-29 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG1665 Protein 5e-31 56
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG1698 Protein 3e-29 56
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG1709 Protein 6e-29 56
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG0792 Protein 6e-29 56
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG1052 Protein 1e-28 55
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG1517 Protein 7e-22 54
Sinme_6679 YP_004557808.1 IS66 Orf2 family protein VFG1737 Protein 2e-29 50