Gene Information

Name : Sphch_1141 (Sphch_1141)
Accession : YP_004553337.1
Strain :
Genome accession: NC_015593
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1235210 - 1235875 bp
Length : 666 bp
Strand : +
Note : KEGG: sjp:SJA_C1-23110 OmpR-family two-component system response regulator PhoP; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver reg

DNA sequence :

ATGCGTCTGCTGATCGTCGAAGATGAACCGAGCCTTGGGCAACAGCTCCGCAATACGCTGGAGGGCGCGGGCTATGCCGT
GGACCTGGCCGATGATGGCGAGGACGGGCATTTTCTGGGCGCGACCGAAAATTATGACGCGGTGGTGCTGGACCTGGGCC
TGCCGACCATCGACGGGCTGACCGTGCTGGACCGCTGGCGCAAGGAAGGCCGGGGCTTTCCGGTGCTGGTGCTGACCGCG
CGCGACAGCTGGTCGGACAAGGTCGCCGGGCTGGACGCGGGCGCTGACGATTATCTGGCCAAGCCGTTTCAGAGCGAGGA
ATTGATCGCCCGGCTGCGCGCGTTGATCCGCCGCGCTTCGGGCAATGCGTCAAGCGAACTGACGGCGGGCGACGTGCGGT
TGGACACGCGGTCGGGCAAGGTGACGCTGAAGGGCGAGCCGGTGAAGCTGACCGCGCAGGAATATAAGCTGCTGTCCTAC
CTCCTCCACCACAAGGGCAAGGTGGTGAGCCGCACCGAACTGATCGAACATATTTACGATCAGGATTTCGACCGCGATTC
CAACACGATCGAAGTGTTCGTGACGCGCATCCGCAAGAAGCTGGGCGCCGACGTCATCACGACGATCCGGGGCCTGGGCT
ATAGTCTGGATGAGCCGGGGCGGTAA

Protein sequence :

MRLLIVEDEPSLGQQLRNTLEGAGYAVDLADDGEDGHFLGATENYDAVVLDLGLPTIDGLTVLDRWRKEGRGFPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQSEELIARLRALIRRASGNASSELTAGDVRLDTRSGKVTLKGEPVKLTAQEYKLLSY
LLHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGADVITTIRGLGYSLDEPGR

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
armR	AAN62112.1	putative response-regulator ArmR	Not tested	PAGI-2(C)	Protein	3e-22	42

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0487	Protein	3e-25	47
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	NC_002516.2.879194.p	Protein	5e-33	46
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	CP004022.1.gene1005.	Protein	1e-31	44
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	CP000034.1.gene2022.	Protein	2e-31	44
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0530	Protein	3e-32	44
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	CP001918.1.gene2526.	Protein	7e-31	43
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	NC_002695.1.913289.p	Protein	2e-31	43
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	CP000647.1.gene1136.	Protein	4e-32	43
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	CP001138.1.gene1939.	Protein	1e-31	43
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0197	Protein	3e-26	43
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0111	Protein	1e-27	42
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0308	Protein	1e-21	42
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0347	Protein	2e-22	41
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	BAC0083	Protein	4e-22	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	VFG0473	Protein	1e-22	44
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	VFG1390	Protein	7e-22	43
Sphch_1141	YP_004553337.1	winged helix family two component transcriptional regulator	VFG0475	Protein	1e-31	43