Gene Information

Name : Sphch_1141 (Sphch_1141)
Accession : YP_004553337.1
Strain :
Genome accession: NC_015593
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1235210 - 1235875 bp
Length : 666 bp
Strand : +
Note : KEGG: sjp:SJA_C1-23110 OmpR-family two-component system response regulator PhoP; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver reg

DNA sequence :
ATGCGTCTGCTGATCGTCGAAGATGAACCGAGCCTTGGGCAACAGCTCCGCAATACGCTGGAGGGCGCGGGCTATGCCGT
GGACCTGGCCGATGATGGCGAGGACGGGCATTTTCTGGGCGCGACCGAAAATTATGACGCGGTGGTGCTGGACCTGGGCC
TGCCGACCATCGACGGGCTGACCGTGCTGGACCGCTGGCGCAAGGAAGGCCGGGGCTTTCCGGTGCTGGTGCTGACCGCG
CGCGACAGCTGGTCGGACAAGGTCGCCGGGCTGGACGCGGGCGCTGACGATTATCTGGCCAAGCCGTTTCAGAGCGAGGA
ATTGATCGCCCGGCTGCGCGCGTTGATCCGCCGCGCTTCGGGCAATGCGTCAAGCGAACTGACGGCGGGCGACGTGCGGT
TGGACACGCGGTCGGGCAAGGTGACGCTGAAGGGCGAGCCGGTGAAGCTGACCGCGCAGGAATATAAGCTGCTGTCCTAC
CTCCTCCACCACAAGGGCAAGGTGGTGAGCCGCACCGAACTGATCGAACATATTTACGATCAGGATTTCGACCGCGATTC
CAACACGATCGAAGTGTTCGTGACGCGCATCCGCAAGAAGCTGGGCGCCGACGTCATCACGACGATCCGGGGCCTGGGCT
ATAGTCTGGATGAGCCGGGGCGGTAA

Protein sequence :
MRLLIVEDEPSLGQQLRNTLEGAGYAVDLADDGEDGHFLGATENYDAVVLDLGLPTIDGLTVLDRWRKEGRGFPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQSEELIARLRALIRRASGNASSELTAGDVRLDTRSGKVTLKGEPVKLTAQEYKLLSY
LLHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGADVITTIRGLGYSLDEPGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-25 47
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 5e-33 46
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 1e-31 44
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 2e-31 44
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0530 Protein 3e-32 44
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 4e-32 43
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 7e-31 43
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 2e-31 43
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 1e-31 43
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-26 43
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-27 42
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-21 42
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-22 41
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-22 44
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator VFG1390 Protein 7e-22 43
Sphch_1141 YP_004553337.1 winged helix family two component transcriptional regulator VFG0475 Protein 1e-31 43