Gene Information

Name : Sinme_5343 (Sinme_5343)
Accession : YP_004551071.1
Strain :
Genome accession: NC_015591
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 65349 - 65753 bp
Length : 405 bp
Strand : -
Note : KEGG: rhi:NGR_c22280 putative transcriptional regulator, MerR family; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGGTACAGAGTCAAGGCCTTCAAGAACTGACGATCGGAAAACTTGCGGCTGCCGGAGGCGTGGGTGTTGAAACCATCCG
ATTCTACCAGCGCAAGGGCCTGCTGGCGACGCCGAAGCGGTCAGAAGGCGTGCGCCGCTATGGAGGCGAGGACGTGCGCC
GACTACGTTTCATAAAACAGGCGCAGGCGGCCGGTTTCACGCTTGAGGAGATCGGGCAGCTTCTGGCACTGGATGCCGGG
CACAACCGCTCGGCTGCACGGGAACTGGCGAAGAAGAAGCTTGAGCAGCTGGATGCCAGGATTGGAGAGCTTAATCGCGC
CCGGGAAGCACTCCGTAAGCTGGTCTCTGAATGCGCAGAGGACAAGACCGGACCGTGTCCCATCCTGGCTTCCTTTGGAG
TTTGA

Protein sequence :
MVQSQGLQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRSEGVRRYGGEDVRRLRFIKQAQAAGFTLEEIGQLLALDAG
HNRSAARELAKKKLEQLDARIGELNRAREALRKLVSECAEDKTGPCPILASFGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-25 50
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-25 48
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-26 47
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-25 47
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-25 47
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-25 47
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-25 47
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-25 47
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-25 47
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 9e-26 46
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 6e-26 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0684 Protein 4e-27 47
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0688 Protein 4e-27 47
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0686 Protein 5e-26 47
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0683 Protein 2e-26 46
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0687 Protein 3e-26 46
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0232 Protein 3e-26 46
Sinme_5343 YP_004551071.1 MerR family transcriptional regulator BAC0689 Protein 4e-26 46