Gene Information

Name : Desru_2639 (Desru_2639)
Accession : YP_004546151.1
Strain : Desulfotomaculum ruminis DSM 2154
Genome accession: NC_015589
Putative virulence/resistance : Resistance
Product : penicillinase repressor
Function : -
COG functional category : K : Transcription
COG ID : COG3682
EC number : -
Position : 2700206 - 2700580 bp
Length : 375 bp
Strand : +
Note : PFAM: Penicillinase repressor; KEGG: cbe:Cbei_3104 CopY family transcriptional regulator

DNA sequence :
ATGAAGGATATTCCTCAAATATCCAATGCGGAATGGGAAGTTATGCGCATCCTCTGGGACAAAGCCCCCATCAAAGCGGC
GGAGGTTATAAAAACCTTGCAAGAGACCAAAGACTGGAAGCCTAAAACCATCAAAACCCTGATCCGGCGTTTATTGGACA
AAGGGGTGATTGGCCATACAGCCAACGGAAATGCCTATGTTTATCACGTGCTGATTGAAGAAAAGGAGTACCTGGACAGG
GAAACAGACACCTTTTTAAATAAATTATATCAGGGTTCCATCCGCCATTTTATGCTGAACTTTGTCCAGGAGAAGGAGCT
TTCCCGGGAAGAGGTGGCAGAACTGATAAAAATTTTGGAAAACAGTAAAAGGTAG

Protein sequence :
MKDIPQISNAEWEVMRILWDKAPIKAAEVIKTLQETKDWKPKTIKTLIRRLLDKGVIGHTANGNAYVYHVLIEEKEYLDR
ETDTFLNKLYQGSIRHFMLNFVQEKELSREEVAELIKILENSKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 1e-20 43
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 1e-20 43
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 7e-21 43
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 6e-19 42
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 3e-20 42
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 1e-21 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desru_2639 YP_004546151.1 penicillinase repressor CP001581.1.gene771.p Protein 7e-27 43
Desru_2639 YP_004546151.1 penicillinase repressor AM180355.1.gene595.p Protein 4e-25 43
Desru_2639 YP_004546151.1 penicillinase repressor NC_002745.1122814.p0 Protein 3e-21 43
Desru_2639 YP_004546151.1 penicillinase repressor NC_002952.2861158.p0 Protein 2e-19 42
Desru_2639 YP_004546151.1 penicillinase repressor NC_002758.1120003.p0 Protein 1e-20 42
Desru_2639 YP_004546151.1 penicillinase repressor NC_009782.5560220.p0 Protein 1e-20 42
Desru_2639 YP_004546151.1 penicillinase repressor FR823292.1.gene6.p01 Protein 4e-22 42
Desru_2639 YP_004546151.1 penicillinase repressor NC_005951.2853407.p0 Protein 2e-18 41
Desru_2639 YP_004546151.1 penicillinase repressor NC_010419.6155809.p0 Protein 2e-18 41
Desru_2639 YP_004546151.1 penicillinase repressor NC_010066.5774788.p0 Protein 2e-18 41
Desru_2639 YP_004546151.1 penicillinase repressor NC_003140.1122763.p0 Protein 2e-18 41
Desru_2639 YP_004546151.1 penicillinase repressor NC_005011.2598314.p0 Protein 2e-18 41