Gene Information

Name : Isova_2812 (Isova_2812)
Accession : YP_004543395.1
Strain : Isoptericola variabilis 225
Genome accession: NC_015588
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3075174 - 3075836 bp
Length : 663 bp
Strand : -
Note : KEGG: kfl:Kfla_0268 winged helix family two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver reg

DNA sequence :
ATGAACCGCATCCTCGTGGCGGAGGACGAGGCGCGCATCGCGCAGTTCGTGCAGAAGGGCCTGCGGGCGCACGGGTTCGT
GCCGACGGTGGTCGCCGACGGACGCACGGCGCTGCAGCACGCGATCAGCGACGAGTTCGACCTCATGGTGCTCGACATCG
GGCTGCCGGACCTGGACGGGTTCCAGGTCCTGGCGCGGCTGCGCGACGTCGGATCGACGATGCCGGTGATCATCCTGACC
GCGCGCGACTCGATCTCCGACCGGGTGGCCGGGCTGCAGGGCGGGGCCGACGACTACATGTCCAAGCCGTTCGGCTTCGA
GGAGCTGCTCGCGCGGATCCGCCTGCGGCTGCGCGACCCGGCGTCGCGCGCGGCGGACGACGCGGTGCTCGAGCGCGGCG
GGCTGCGCATGGACGTCACCGCGCGGCGCGTCTCGGTGGACGGGCGCGACGTCGACCTGTCGGCGCGCGAGTTCGCGCTC
GCCGAGGTGTTCCTGCGGCACGCGGGCCAGGTGCTCTCGCGCGAGCAGCTGCTCTCGCGCGTCTGGGGCTACGACTTCGA
CCCGGGCTCGAACGTCGTCGACGTCTACGTGCGCTACCTGCGCAAGAAGCTGGGCGCCGACCGCATCCAGACCGTGCGCG
GGTCGGGCTACCGCCTGCCCTGA

Protein sequence :
MNRILVAEDEARIAQFVQKGLRAHGFVPTVVADGRTALQHAISDEFDLMVLDIGLPDLDGFQVLARLRDVGSTMPVIILT
ARDSISDRVAGLQGGADDYMSKPFGFEELLARIRLRLRDPASRAADDAVLERGGLRMDVTARRVSVDGRDVDLSAREFAL
AEVFLRHAGQVLSREQLLSRVWGYDFDPGSNVVDVYVRYLRKKLGADRIQTVRGSGYRLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-34 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 43
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-35 47
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-37 46
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-39 45
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-35 44
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0083 Protein 1e-39 44
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-33 42
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-35 42
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-37 42
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-35 41
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family BAC0308 Protein 6e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-38 48
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-34 44
Isova_2812 YP_004543395.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-35 43