Gene Information

Name : Isova_2635 (Isova_2635)
Accession : YP_004543232.1
Strain : Isoptericola variabilis 225
Genome accession: NC_015588
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2880825 - 2881541 bp
Length : 717 bp
Strand : -
Note : KEGG: xce:Xcel_2969 winged helix family two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver reg

DNA sequence : 
GTGACGCGCATCCTGGTGGTGGAGGACGAGGACTCGTACCGGGACCCGCTGACGTATCAGCTGACCCGCGAGGGGTACGA
GGTGGTCGAGGCGTCGAACGGCCACGACGCGCTCGCGGCGTTCGACGACGGCGGTGCGGACCTCGTCCTGCTCGACCTCA
TGCTGCCCGGCCTGAGCGGCACCGAGGTGTGCCGCGAGCTGCGCCAGCGCGGCGACGTGCCCGTCATCATGCTCACGGCC
AAGGACTCCGAGATCGACAAGGTCGTGGGCCTCGAGCTCGGCGCCGACGACTACGTCACCAAGCCGTACTCGTTCCGCGA
GCTGCTGGCCCGCATGCGGGCCGTGATGCGCCGTCGCGGCCCCGCGGCGTCGGACAACGGCACGGGCGGGCACGACGACG
GCGGGGACGCGGTCCTCGAGGTCGGGCCCGTCCGCATGGACGTCGAGCGGCACACGGTGACGGTCGACGGCGAGCCCGTG
TCGCTGCCGCTCAAGGAGTTCGACCTGCTCGAGCTCCTGCTGCGCAACGCGGGCCGCGTGCTCACGCGCGGGCAGCTCAT
CGACCGCGTCTGGGGCGCGGACTACGTCGGCGACACCAAGACGCTCGACGTCCACGTGAAGCGCATCCGGGCGAAGATCG
AGCCCGACCCGGGCTCGCCGCGCTACCTGCTGACCGTGCGCGGTCTCGGCTACAAGCTGGCCGACGACGAGGTCTGA

Protein sequence : 
MTRILVVEDEDSYRDPLTYQLTREGYEVVEASNGHDALAAFDDGGADLVLLDLMLPGLSGTEVCRELRQRGDVPVIMLTA
KDSEIDKVVGLELGADDYVTKPYSFRELLARMRAVMRRRGPAASDNGTGGHDDGGDAVLEVGPVRMDVERHTVTVDGEPV
SLPLKEFDLLELLLRNAGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRIRAKIEPDPGSPRYLLTVRGLGYKLADDEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-16 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-26 46
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-24 44
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-28 42
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-13 42
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 6e-16 41
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-26 41
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-12 41
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-17 42
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-17 42
Isova_2635 YP_004543232.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-14 41