Gene Information

Name : Isova_2358 (Isova_2358)
Accession : YP_004542969.1
Strain : Isoptericola variabilis 225
Genome accession: NC_015588
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2570089 - 2570769 bp
Length : 681 bp
Strand : -
Note : KEGG: xce:Xcel_2514 winged helix family two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver reg

DNA sequence :
ATGAAGTCCCGCGTTCTTGTGGTCGACGACGACACCGCCCTGTCCGAGATGATCGGCATCGTCCTGAAGTCGGAGGGGTT
CGAGCCGGTCTTCTGCGCGGACGGCGACTCGGCCATCGCGGAGTTCCGCGCCCAGCAGCCCGACCTCGTGCTGCTCGACC
TCATGCTGCCGGGCAAGGACGGGATCGAGGTCGCCCGCGAGATCCGGTCGGAGTCGGGCGTGCCGATCATCATGCTGACC
GCCAAGAGCGACACGGTCGACGTCGTGCTCGGGCTCGAGTCGGGCGCCGACGACTACGTCTCCAAGCCGTTCAAGCCCAA
GGAGCTCGTCGCCCGCATCCGCGCGCGCCTGCGCCGCTCCGACGAGCCGGGCCCCGAGCGGCTGCGCGTCGGCGACGTCG
AGATCGACGTCACCGGCCACAGCGTCACCCGGGACGGCGAGCGCATCAGCCTCACCCCGCTCGAGTTCGACCTCCTGGTC
GCGCTCGCGCGCAAGCCCTGGCAGGTGTTCACGCGGGAGGTCCTCCTCGAGAAGGTGTGGGGCTACCGGCACAGCGCCGA
CACCCGCCTCGTCAACGTCCACGTGCAGCGCCTGCGCTCGAAGATCGAGAAGGACCCGGAGAACCCCGAGGTGGTGCTGA
CGGTGCGCGGCGTGGGCTACAAGGCCGGTGCCCCGCGCTGA

Protein sequence :
MKSRVLVVDDDTALSEMIGIVLKSEGFEPVFCADGDSAIAEFRAQQPDLVLLDLMLPGKDGIEVAREIRSESGVPIIMLT
AKSDTVDVVLGLESGADDYVSKPFKPKELVARIRARLRRSDEPGPERLRVGDVEIDVTGHSVTRDGERISLTPLEFDLLV
ALARKPWQVFTREVLLEKVWGYRHSADTRLVNVHVQRLRSKIEKDPENPEVVLTVRGVGYKAGAPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-29 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-76 74
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-47 49
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-45 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-45 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 9e-46 45
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-34 43
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 1e-39 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-42 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 4e-36 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 9e-33 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 2e-35 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family BAC0596 Protein 5e-36 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-36 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 1e-36 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-36 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 5e-36 41
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family BAC0039 Protein 1e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-33 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family VFG1389 Protein 4e-29 42
Isova_2358 YP_004542969.1 two component transcriptional regulator, winged helix family VFG1702 Protein 4e-36 41