Gene Information

Name : Isova_2327 (Isova_2327)
Accession : YP_004542940.1
Strain : Isoptericola variabilis 225
Genome accession: NC_015588
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2537589 - 2538353 bp
Length : 765 bp
Strand : +
Note : manually curated; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; KEGG: xce:Xcel_2485 winged helix family two component transcriptional regulator; SMART: Signal transduction response regul

DNA sequence :
GTGCAAGATGGGCCCATGACGACCACTCCCCCTGCAGCGGCCGGCGGCTCCGGCCCGGCCGTCGCCGGACAGCAGAGCGC
GACCGTGCTCGTCGTGGAGGACGAGCCGGCGATCGCCACCGCGATCGCGCAGCGACTGTCGGCGGAGGGCTGGCGCGTCG
AGGTCGCGCGCGACGGCCTCTCGGGCGTCGACGCCGCGGCCCGGCTCCAGCCCGACGCCGTCGTCCTCGACGTCATGCTG
CCCGGCATCGACGGGCTCGAGGTGACGCGACGCATCCAGGCCGAGCGCCCCGTGCCGATCCTCATGCTCACGGCCCGCGA
CGACGAGACCGACATGCTCGTCGGGCTCGGCGTCGGCGCGGACGACTACATGACCAAGCCGTTCTCCATGCGCGAGCTCG
TCGCGCGCGTGAAGGCGCTGCTGCGGCGGGTCGAGCGGGCGGCCCAGGTCGTCGTCACCGCGCCGGCCGACCCGCCGATC
GTCATGGGAGACGTGACGATCGACCGCGCCCAGCGCCGGGTGCACCGGGGCGGCGAGGAGGTCCACCTCACGCCGACCGA
GTTCGAGCTGCTCGTCATGCTGGCGAGCTCCCCCAAGACCGTCCTCACGCGCGAGCGGCTGCTCGCCGAGGTGTGGGACT
GGGCGGACGCGAGCGGGACGCGCACCGTCGACTCGCACATCAAGGCGCTGCGCCGCAAGCTCGGGGCGGACCTCATCCGC
ACCGTGCACGGCGTCGGGTACGCCTTCGAGCCGCCGGCAGGCTGA

Protein sequence :
MQDGPMTTTPPAAAGGSGPAVAGQQSATVLVVEDEPAIATAIAQRLSAEGWRVEVARDGLSGVDAAARLQPDAVVLDVML
PGIDGLEVTRRIQAERPVPILMLTARDDETDMLVGLGVGADDYMTKPFSMRELVARVKALLRRVERAAQVVVTAPADPPI
VMGDVTIDRAQRRVHRGGEEVHLTPTEFELLVMLASSPKTVLTRERLLAEVWDWADASGTRTVDSHIKALRRKLGADLIR
TVHGVGYAFEPPAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-41 46
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-38 45
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-42 44
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-41 43
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-35 43
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-38 42
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family VFG1390 Protein 8e-40 44
Isova_2327 YP_004542940.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-30 41