Gene Information

Name : PP1Y_AT20981 (PP1Y_AT20981)
Accession : YP_004534788.1
Strain : Novosphingobium sp. PP1Y
Genome accession: NC_015580
Putative virulence/resistance : Virulence
Product : two-component system OmpR family response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2225964 - 2226641 bp
Length : 678 bp
Strand : +
Note : assigned by KAAS to KEGG Orthology:K02483 two-component system, OmpR family, response regulator

DNA sequence :
TTGCGCATCCTGATCGTCGAGGATGAACCTACGCTCGGCAACCAGCTCAAGACCACGCTCGAGCAGAACGGCTATGCCGT
CGACCTGTCGACAGACGGCGAAGACGGCCATTTTCTTGGATCGACCGAGGATTACGACGCCGTCATCCTCGATCTCGGCT
TGCCCGAGATCGACGGCCTCACCGTGCTTGGCATGTGGCGCAGGGAAGGGCGCAATTTCCCCGTGCTTGTACTTACCGCC
CGTGATTCCTGGTCGGACAAGGTCGCCGGGCTCGATGCCGGCGCGGACGACTATCTCGCCAAGCCATTCCAGACCGAGGA
ACTGATCGCCCGACTTCGCGCGCTCATCCGCCGTGCCTCTGGCAATACCTCGAGCGAGTTGATGGCGGGCGACGTGCGCC
TCGACACGCGTTCGGGCCGCGTCACGCTGGCCGGTGAACCGGTCAAGCTGACCGCGCAGGAATACAAGCTGCTGTCCTAC
CTGATGCACCACAAGGGCAAGGTGGTCAGCCGTACCGAACTGATCGAACACATCTACGATCAGGACTTCGACCGCGATTC
CAATACGATCGAGGTCTTCGTCACGCGGATCCGCAAGAAGCTGGGCGCCGATGTCATCACCACGATCCGTGGTCTCGGGT
ACAGCCTCGACGATCCCGCGGACGCACCGCGAAACTGA

Protein sequence :
MRILIVEDEPTLGNQLKTTLEQNGYAVDLSTDGEDGHFLGSTEDYDAVILDLGLPEIDGLTVLGMWRREGRNFPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQTEELIARLRALIRRASGNTSSELMAGDVRLDTRSGRVTLAGEPVKLTAQEYKLLSY
LMHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGADVITTIRGLGYSLDDPADAPRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator NC_002516.2.879194.p Protein 1e-32 46
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0487 Protein 9e-26 45
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0530 Protein 3e-31 44
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator CP000647.1.gene1136. Protein 3e-31 43
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator CP004022.1.gene1005. Protein 1e-30 43
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator CP001918.1.gene2526. Protein 5e-30 43
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator CP001138.1.gene1939. Protein 9e-31 43
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator CP000034.1.gene2022. Protein 3e-30 42
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0308 Protein 2e-21 42
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator NC_002695.1.913289.p Protein 2e-30 42
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0347 Protein 4e-23 41
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0083 Protein 3e-22 41
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0197 Protein 3e-25 41
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator BAC0125 Protein 7e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator VFG0473 Protein 6e-23 44
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator VFG0475 Protein 8e-31 43
PP1Y_AT20981 YP_004534788.1 two-component system OmpR family response regulator VFG1390 Protein 5e-22 42