Gene Information

Name : mtrA (JDM601_2986)
Accession : YP_004524240.1
Strain : Mycobacterium sp. JDM601
Genome accession: NC_015576
Putative virulence/resistance : Virulence
Product : two-component sensory transduction transcriptional regulatory protein MtrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3195028 - 3195714 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGTACGCCATGAGGCAAAGGATTCTCGTCGTCGATGACGACGCTTCGCTGGCCGAGATGCTCACCATCGTGCTGCGCGG
GGAGGGTTTCGACACCGCGGTCGTCGGCGACGGCACCCAGGCGCTCACCGCGGTGCACGAGCTGCGGCCCGATCTAGTGC
TGCTGGACCTGATGCTGCCCGGCATGAACGGCATCGACGTGTGCCGGGTGCTGCGCAAGGACTCCGGGGTGCCGATCGTG
ATGCTCACCGCCAAGACCGACACCGTCGACGTGGTGCTCGGGCTGGAGTCGGGTGCTGACGACTACATCATGAAGCCGTT
CAAGCCCAAGGAGCTGGTCGCCCGGGTGCGCGCGCGGCTGCGCCGCAACGACGACGAGCCGGCCGAGATGCTCTCGATCG
CCGACATCGACATCGACGTGCCGGCACACAAGGTCAGCCGCGGCGGTGAGCAGATCTCCCTGACGCCGCTGGAATTCGAC
CTGCTGGTGGCGCTGGCACGCAAACCCCGCCAGGTGTTTACTCGGGAGGTGCTCCTCGAACAGGTCTGGGGATACCGGCA
CCCGGCCGACACCCGGCTGGTGAACGTGCACGTCCAGCGCCTGCGGGCCAAAGTAGAGCAAGACCCGGAGAATCCGACCG
TGGTGCTGACCGTTCGAGGAGTGGGTTACAAGGCCGGACCTCCGTGA

Protein sequence :
MYAMRQRILVVDDDASLAEMLTIVLRGEGFDTAVVGDGTQALTAVHELRPDLVLLDLMLPGMNGIDVCRVLRKDSGVPIV
MLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADIDIDVPAHKVSRGGEQISLTPLEFD
LLVALARKPRQVFTREVLLEQVWGYRHPADTRLVNVHVQRLRAKVEQDPENPTVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA AE000516.2.gene3505. Protein 1e-86 96
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_002952.2859905.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_003923.1003749.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_002758.1121668.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_009641.5332272.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_013450.8614421.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_007793.3914279.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_007622.3794472.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_002745.1124361.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_009782.5559369.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_002951.3237708.p0 Protein 2e-36 46
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA AE015929.1.gene1106. Protein 3e-25 43
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA BAC0125 Protein 3e-28 43
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA HE999704.1.gene2815. Protein 4e-31 43
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA BAC0347 Protein 7e-19 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_012469.1.7685629. Protein 1e-32 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA BAC0039 Protein 4e-28 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA CP000034.1.gene2186. Protein 4e-28 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA CP001918.1.gene3444. Protein 3e-28 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_002695.1.916589.p Protein 3e-28 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA BAC0111 Protein 5e-22 41
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA NC_012469.1.7686381. Protein 7e-34 41
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA BAC0197 Protein 5e-24 41
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA CP004022.1.gene1676. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA VFG1390 Protein 3e-28 43
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA VFG1389 Protein 4e-24 42
mtrA YP_004524240.1 two-component sensory transduction transcriptional regulatory protein MtrA VFG1702 Protein 2e-30 41