Gene Information

Name : Metme_1389 (Metme_1389)
Accession : YP_004512312.1
Strain : Methylomonas methanica MC09
Genome accession: NC_015572
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1507862 - 1508590 bp
Length : 729 bp
Strand : -
Note : KEGG: two component transcriptional regulator winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGAGTGAGCTTTCCCCTAAACCCAACAATGCCGGCGACTTCGGTTTCCTGCGCATTCTGTTGGTCGAAGACGATAAACG
GATTGCCGATTTCGTCGAACGCGGCCTGAAAGCCGAAGGCTATGCCGTAGAAGTGGCCCGCTGCGGGCAGGACGCCATTG
CCATCGGCTGCGAGAGTCAATTTCAGGCGATTATTCTGGATTTGGGTCTGCCGGACATCAACGGCCGCGAGGTGTGCGAG
CGATTGCGTAAGCACAGTGTCGACACTCCCATCCTGATGCTGACCGCCCGCGACACGGTTCAGGATAAAGTCACCGGCCT
GCGTTCGGGTGCCGACGATTACATGACCAAACCGTTTGCTTTTGAAGAACTGTTGGCGCGAATTGAAGTTTTGATGCGCC
GACGCAGCGGCGAGATCAAACTGGACTCGAAAGAGCTGCAAATGGCCGACTTGCTGTTGAATGTGGATACGCACGAAGTC
AAACGCGGGGACACCTCCATAGAATTGACACCCAAGGAATTTGCGTTGCTGGAATGCTTTATGCGCATGCCGGGCAAGGT
GTTAAGCCGTACCCGGATTTTGGAACAGGTATGGGGCTACAGCGCCGACCCGTTGACCAATGTGGTGGATGTGTATATCC
GCCAGCTGCGCCGCAAGATCGATGACGATTTCGAGTTGAAACTGCTGAAAACGGTACGCGGTTACGGTTACAAAATGGAC
GCAAGCTAA

Protein sequence :
MSELSPKPNNAGDFGFLRILLVEDDKRIADFVERGLKAEGYAVEVARCGQDAIAIGCESQFQAIILDLGLPDINGREVCE
RLRKHSVDTPILMLTARDTVQDKVTGLRSGADDYMTKPFAFEELLARIEVLMRRRSGEIKLDSKELQMADLLLNVDTHEV
KRGDTSIELTPKEFALLECFMRMPGKVLSRTRILEQVWGYSADPLTNVVDVYIRQLRRKIDDDFELKLLKTVRGYGYKMD
AS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-43 48
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-37 47
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-44 45
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-47 44
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-38 44
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0308 Protein 8e-41 43
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-37 43
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-29 42
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-29 42
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-41 41
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 9e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-45 47
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-41 42
Metme_1389 YP_004512312.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-38 41