Gene Information

Name : DelCs14_5650 (DelCs14_5650)
Accession : YP_004490975.1
Strain : Delftia sp. Cs1-4
Genome accession: NC_015563
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6353508 - 6354182 bp
Length : 675 bp
Strand : -
Note : KEGG: dac:Daci_0876 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region; Signal transduc

DNA sequence : 
ATGCGCATTCTGATTGCCGAAGACGACCAGGTCCTGGCCGATGGTCTGCTGCGCAGCCTGCGCGGCTCGGGCGCCGTGGT
CAGCCATGTGGCCAACGGCAGCGAGGCCGATACCGCGCTGATGACCAGCAGCGAGTTCGACCTGCTCATCCTGGACCTGG
GCCTGCCCAAGATGCACGGGCTCGAAGTGCTCAAGAAGCTGCGCGGCCGGGGCGATGCGCTGCCGGTGCTCATCCTCACG
GCAGCCGACAGCGTGGAAGAGCGCGTGCAGGGGCTGGACTACGGCGCCGACGACTACATGGCCAAGCCGTTTGCGCTGTC
CGAGCTGGAGGCGCGTGTGCGCGCTCTCACGCGGCGCGGCATGGGTGGCGCCAGCAGCACCATCAAGCACGGCCCCCTGG
TCTACGACCAGGCCGGCCGCGTGGCCACCATCGACGGCAAGATGGTCGAGCTGTCGGCGCGCGAGCTGGGCCTGCTGGAA
GTGCTGCTGCAGCGGGCCGGGCGGCTGGTCAGCAAGGACCAGTTGGTCGAGCGCCTGTGCGAATGGGGCGACGAGGTCAG
CAACAACGCCATCGAGGTCTATATCCACCGCCTGCGCAAGAAGATAGAGCGCGGCCCCATCCGCATCGCCACCGTGCGCG
GCCTGGGCTACTGCCTTGAGAAGATCGCTTCCTGA

Protein sequence : 
MRILIAEDDQVLADGLLRSLRGSGAVVSHVANGSEADTALMTSSEFDLLILDLGLPKMHGLEVLKKLRGRGDALPVLILT
AADSVEERVQGLDYGADDYMAKPFALSELEARVRALTRRGMGGASSTIKHGPLVYDQAGRVATIDGKMVELSARELGLLE
VLLQRAGRLVSKDQLVERLCEWGDEVSNNAIEVYIHRLRKKIERGPIRIATVRGLGYCLEKIAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-37 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator BAC0487 Protein 6e-36 46
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator BAC0638 Protein 4e-27 44
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-33 43
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-33 43
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-37 43
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-32 42
DelCs14_5650 YP_004490975.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-28 41