Gene Information

Name : DelCs14_5429 (DelCs14_5429)
Accession : YP_004490754.1
Strain : Delftia sp. Cs1-4
Genome accession: NC_015563
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6120903 - 6121601 bp
Length : 699 bp
Strand : -
Note : TIGRFAM: Signal transduction response regulator, heavy metal response; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; KEGG: dac:Daci_1091 two component heavy metal response transcriptiona

DNA sequence :
ATGCTCGGCATGAAAGTCCTGGTCATCGAAGACGAAATCAAGCTGGCCGACTACCTCCGCAAGGGCCTGACCGAGGAGGG
GTTCGTGGTCGATGTCGCGCACGACGGCATCGACGGCCTGCACCTGGCCACCGAGCTGGCCTACGACCTCATCGTGCTCG
ACGGCATGCTGCCCGGCATCGACGGCCTGGCCGTGCTGGCGGCGCTGCGCCAGTCGCGCCAGACACCGGTGCTGATGCTG
ACGGCGCGCGGCCAGGTGGAAGACCGCGTGCGCGGCCTGCAGGGCGGCGCCGACGACTACCTGGTCAAGCCCTTTGCCTT
CTCCGAACTGGTGGCGCGCATGCATGTGCTGCTGCGCCGCAGTGTCGGCACGGCGCATCCGGCGGCCGAGGCCACCATGC
TGCGCATGGCCGACCTGGAGCTGGACCTGATCCGCCGACGCGCCACGCGCGCCGGCCAGCGCCTGGACCTCACGGCCAAG
GAATTCAACCTGCTGAGCCTGCTGCTGCGCCGCCAGGGCGAGGTGCTGTCGCGCACCGAGCTGGCCTCCCAGGTCTGGGA
CATGAACTTCGACAGCGAGACCAACGTGGTCGAGGTGGCCGTGCGCCGCCTGCGCCTGAAGCTGGACCAGCCCTTCGAAC
AGCCGCTGCTGCACACGGTGCGCGGCATGGGCTATGTGCTGGAGTCGCGCGCACCGTGA

Protein sequence :
MLGMKVLVIEDEIKLADYLRKGLTEEGFVVDVAHDGIDGLHLATELAYDLIVLDGMLPGIDGLAVLAALRQSRQTPVLML
TARGQVEDRVRGLQGGADDYLVKPFAFSELVARMHVLLRRSVGTAHPAAEATMLRMADLELDLIRRRATRAGQRLDLTAK
EFNLLSLLLRRQGEVLSRTELASQVWDMNFDSETNVVEVAVRRLRLKLDQPFEQPLLHTVRGMGYVLESRAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-57 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-56 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-66 62
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 4e-65 60
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-53 60
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 4e-59 59
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 9e-60 56
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-56 54
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-54 51
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-34 44
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 1e-33 43
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 8e-25 42
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 3e-28 42
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family BAC0533 Protein 6e-28 42
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 5e-28 42
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 6e-28 42
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 5e-28 42
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-37 41
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-57 55
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 1e-38 48
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-41 44
DelCs14_5429 YP_004490754.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 6e-36 42