Gene Information

Name : DelCs14_3818 (DelCs14_3818)
Accession : YP_004489162.1
Strain : Delftia sp. Cs1-4
Genome accession: NC_015563
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 4325642 - 4326106 bp
Length : 465 bp
Strand : -
Note : KEGG: dac:Daci_2916 MerR family transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGTCACAGCATGAATCTGCGCGCTGGCGCATCGGCGAGGCGGCCAAGCGTTCCGGCGTGGCCGCCGCCAACATCCGCTA
CTACGAGAAGGAAAGGCTGCTCAGTGCAGGCGTGCGCGAGGACAACCAGTACCGGCTGTACAGCGACAGCGATGTGCACC
GGCTGCGCTTCATCCGCCTGTGCCGCGCCATGGACATGTCGCTGGACGAGGTCCGCACCCTGCTGGCGCTGGACGGTGCC
AGCAAGGCCGACTGCGTGGCTGCCAACGAAACCCTGGATGCCCACCTGGGCCATGTGCGCGAGCGCCTGGCCGAGCTGCG
CGCGCTGGAGCATGAGCTGATGCAGCTGCGCAGCCAGTGCGACGGGTCGGACAGCTACTGCCATCTGATCGAGGCCTTGC
ATGCCCAGGCCGACGAACCGCTGGCACCCGCCCTGGGCAGCTCCGGCGCCAAGCGCCATGTGTAG

Protein sequence :
MSQHESARWRIGEAAKRSGVAAANIRYYEKERLLSAGVREDNQYRLYSDSDVHRLRFIRLCRAMDMSLDEVRTLLALDGA
SKADCVAANETLDAHLGHVRERLAELRALEHELMQLRSQCDGSDSYCHLIEALHAQADEPLAPALGSSGAKRHV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-19 43
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-18 42
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-18 42
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-18 42
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-18 42
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-18 42
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-18 42
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-18 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_3818 YP_004489162.1 MerR family transcriptional regulator BAC0301 Protein 2e-22 45