Gene Information

Name : DelCs14_3652 (DelCs14_3652)
Accession : YP_004488999.1
Strain : Delftia sp. Cs1-4
Genome accession: NC_015563
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4135148 - 4135864 bp
Length : 717 bp
Strand : -
Note : KEGG: dac:Daci_3071 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGACCGCCACGCGCCGCGTACTTCTCGTCGAGGACGACGCCCATATCGCCGACCTGCTCACGCTGCACCTGCGCGACGA
AGGCCTGGAAGTCATGCACTGCGCGCGTGGCGACGACGGCCTGCGCCAACTGGAGCGCGGCGGCTGGGACGCGCTGGTGC
TGGACATCATGCTGCCCGGCGTGGACGGTCTGGAGATCTGCCGCCGCGCCCGCGCCATGGCGCGCTACACGCCCATCATC
ATCATCAGCGCGCGCTCCAGCGAGGTGCAGCGCATCCTGGGCCTGGAGATCGGCGCCGACGACTACCTGGCCAAGCCGTT
TTCCGTGCTGGAACTGGTGGCGCGCGTCAAGGCGCTGCTGCGCCGCGTGGAGGCGCTGGCCCAGAATGCCCGGCTGGAGT
CCGGCAGCCTGACCATCGCCGGCCTGGCCATGGACCCCGTGGCGCGCGATGCCCGGCTTCATGGTGCCCGGCTGGACCTG
ACCCCGCGCGAGTTCGACCTGCTGTACTTCTTTGCGCGCCAGCCCGGCAAGGTGTTCTCGCGCATGGACCTGCTCAACGC
CGTCTGGGGCTACCAGCACGAAGGCTACGAGCACACCGTCAACACCCACATCAACCGCCTGCGCGCCAAGATCGAGGCCG
ACCCGGCCCAGCCCGCGCGCATCCTCACCGTCTGGGGGCGCGGCTACAAGTTCGCCGAGGCGGGGGAGGGCGCCTGA

Protein sequence :
MTATRRVLLVEDDAHIADLLTLHLRDEGLEVMHCARGDDGLRQLERGGWDALVLDIMLPGVDGLEICRRARAMARYTPII
IISARSSEVQRILGLEIGADDYLAKPFSVLELVARVKALLRRVEALAQNARLESGSLTIAGLAMDPVARDARLHGARLDL
TPREFDLLYFFARQPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPARILTVWGRGYKFAEAGEGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-70 60
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-70 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-36 45
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-43 43
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-43 42
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-41 42
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-39 41
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-70 60
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-70 60
DelCs14_3652 YP_004488999.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-31 45