Gene Information

Name : DelCs14_0018 (DelCs14_0018)
Accession : YP_004485415.1
Strain : Delftia sp. Cs1-4
Genome accession: NC_015563
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 17185 - 17973 bp
Length : 789 bp
Strand : -
Note : KEGG: dac:Daci_0016 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence : 
ATGCCGGCACCCCCACCGATCTCGGCGGAGTCTGGCGCGCCGTATAGTGTCTGCCTCAGTTTCGAGTCAGGCCCTGCCGC
CCGCATGTACCGCTATCTCATCATCGAAGACGACGCGCTGAACGCGCGCTACATCGCCGAAGGCCTGCGCCAGCAGGGCG
CGCAGGTGGCGGTGTGCAGCGATGGTGTGCAGGGCATCGCCATGGCCGTGGGCGAGAGCTGGGATGTGATCATCCTCGAC
CGCATGCTGCCCAACGGCTTCGACGGCCTGCAGATCCTGCAGACGCTGCGCTCCATGGGCAAGCAGACGCCGGTGCTGGT
GCTCAGCGCCCTGTCGGCCACGGACGAGCGCGTGCGCGGCCTCAAGGCCGGCTGCGATGACTACCTGACCAAGCCCTTTG
CCTTCTCCGAACTCTCGGCGCGCCTGGAGGCCCTGGTGCGCCGCGCCCAGATCCCGGCCCCGGCGCGCGAGATGCGCCTG
GCCGACCTGCGGCTGAACCTGCTCACGCGCAGCGCCGAGCGCGCAGGCCAGCCGCTGGCGCTGCAGCCGCGCGAGTTTCG
CCTGCTGGCCTTTCTGATGCAGCACGCGCACCAGATCGTCACGCGAACCATGCTGCTGGAGTCGGTGTGGGACTACCGGT
TCGACCCGCAGACCAATGTCATCGACGTGCACATCAGCCGCCTGCGCGGCAAGGTGGACAAGGGCTTCGAGCCCGCGCTG
ATCCACACCGTGCGCGGCGTGGGCTACAGCCTGTCGGACCGGCCGCAGGACCTGCCGCAGGTGGCCTGA

Protein sequence : 
MPAPPPISAESGAPYSVCLSFESGPAARMYRYLIIEDDALNARYIAEGLRQQGAQVAVCSDGVQGIAMAVGESWDVIILD
RMLPNGFDGLQILQTLRSMGKQTPVLVLSALSATDERVRGLKAGCDDYLTKPFAFSELSARLEALVRRAQIPAPAREMRL
ADLRLNLLTRSAERAGQPLALQPREFRLLAFLMQHAHQIVTRTMLLESVWDYRFDPQTNVIDVHISRLRGKVDKGFEPAL
IHTVRGVGYSLSDRPQDLPQVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-41 45
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-41 45
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0111 Protein 6e-48 44
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-42 43
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-40 43
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-43 42
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-44 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-37 44
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-34 44
DelCs14_0018 YP_004485415.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-38 41