Gene Information

Name : Thexy_1114 (Thexy_1114)
Accession : YP_004470819.1
Strain : Thermoanaerobacterium xylanolyticum LX-11
Genome accession: NC_015555
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1188170 - 1188856 bp
Length : 687 bp
Strand : +
Note : KEGG: ttm:Tthe_1628 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
ATGGAAGAAAGCATACTCATAATTGAAGATGAGAAAAGAATTGCAAGGTTTTTACAGATAGAGCTTGAACGTGAAGGTTA
TAGTGTAACATTAGAATATAGCGGCAATAGTGGCTTAAGAGAGGCTTTAGATGGAAATTACGATTTGATAATCTTAGACT
TGATGCTTCCAGGTTTGGATGGTTTTTCAGTATTGAGAGAACTACGAAAAAAATCATCGACGCCTGTAATAATTTTAAGT
GCAAAAGATGAGGTAAAAGACAAGGTATTTGGGCTTGATATAGGTGCTGATGATTATCTGACTAAGCCGTTTTCGATTGA
AGAACTTATGGCGAGAATACGAAATGTCCTTAGAAAAAATGCAAAGTCAAATGCTAATAAATTGGTATATGATGGGATAA
CAATGGATTTGTCTACATACGAAGTAAAAAGAGACGGAATAAAGATAGAGCTGACGAAAAAAGAGTTTGAGCTTTTGAAA
TATTTGATTATAAACTCTGAAATAGTGCTTACAAGGGAAAACATACTGGAGAATGTATGGGGCTACAATTATATTGGTGA
GACAAACATAGTAGATGTGTACATAAGGTATTTGCGAAGTAAAATTGATGAACCGTTTGATAATAAGTTGATACAGACGA
TAAGAGGTGTAGGATACTCTTTAAGGAAAGAAAAAAATGAGAATTAA

Protein sequence :
MEESILIIEDEKRIARFLQIELEREGYSVTLEYSGNSGLREALDGNYDLIILDLMLPGLDGFSVLRELRKKSSTPVIILS
AKDEVKDKVFGLDIGADDYLTKPFSIEELMARIRNVLRKNAKSNANKLVYDGITMDLSTYEVKRDGIKIELTKKEFELLK
YLIINSEIVLTRENILENVWGYNYIGETNIVDVYIRYLRSKIDEPFDNKLIQTIRGVGYSLRKEKNEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-49 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-48 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-53 54
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-47 53
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 7e-45 48
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-44 48
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-49 47
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0197 Protein 4e-45 45
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-41 44
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-32 44
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-37 43
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-40 43
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 9e-33 43
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-42 43
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-39 43
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-43 42
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-38 41
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-50 48
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-44 43
Thexy_1114 YP_004470819.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-47 42