Gene Information

Name : Thexy_1076 (Thexy_1076)
Accession : YP_004470781.1
Strain : Thermoanaerobacterium xylanolyticum LX-11
Genome accession: NC_015555
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1151773 - 1152480 bp
Length : 708 bp
Strand : +
Note : KEGG: ttm:Tthe_1754 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
TTGGCACATACAATTCTTGTTATTGAAGATGAAGCCCATATTTTAGAGTTGTTAAGGTACAATTTAGAAGCACAAGGATA
TAATGTTGTTTTAACAGATAATGGCAAAGGTGGCCTTGAAAAATGCAAAGAGACAAACCCCGATCTGGTTCTTTTAGATT
TGATGCTTCCCGATATAGATGGCATAGATGTATGTAAAAAGTTAAAATCAGATGAACATCTTAAAAACATCCCTATAATT
ATGCTGACTGCAAAGAGCGAAGAAGTAGATAAGATATTAGGATTGGAACTTGGGGCAGATGACTACATTACAAAACCTTT
CAGCATAAGAGAGCTGTTGGCAAGGATTAAAGTAGTGCTAAGAAGATCCAAAAATGAGTCTGAAGATAATGAGATCATCA
AGTTTGGAGATATCACGATAGATACTGAAAAACATTTGGTTTATAAAGGCAATGAATTGCTTGATCTCACTTTAAAAGAG
TTTGAGCTTTTAAAACTTTTATCAAAAAATCGAGGCAAAGTTTTGACTCGAGATTATTTGTTGGACAAGGTATGGGGATA
TGAATACGCTGGCGAAACAAGAACTGTGGATGTCCACATACGACATTTGAGAAAAAAGATAGAAGATGATGATAAACTTC
CAGTATACATTGAAACAGTACGTGGGATTGGGTACAAATTAAAGGATATAGGTGAAAGTGATGTTTAA

Protein sequence :
MAHTILVIEDEAHILELLRYNLEAQGYNVVLTDNGKGGLEKCKETNPDLVLLDLMLPDIDGIDVCKKLKSDEHLKNIPII
MLTAKSEEVDKILGLELGADDYITKPFSIRELLARIKVVLRRSKNESEDNEIIKFGDITIDTEKHLVYKGNELLDLTLKE
FELLKLLSKNRGKVLTRDYLLDKVWGYEYAGETRTVDVHIRHLRKKIEDDDKLPVYIETVRGIGYKLKDIGESDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 8e-29 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 5e-29 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-45 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 6e-42 55
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 7e-43 50
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 7e-35 47
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 8e-39 46
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 8e-32 45
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-25 44
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-22 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family BAC0125 Protein 4e-25 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 6e-30 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-24 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family BAC0039 Protein 6e-24 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 5e-24 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 6e-24 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family BAC0596 Protein 5e-24 43
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 8e-26 42
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 8e-23 42
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-23 42
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 6e-28 41
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 6e-28 41
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 5e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family VFG1563 Protein 9e-24 41
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family VFG1702 Protein 3e-24 41
Thexy_1076 YP_004470781.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-31 41