Gene Information

Name : ambt_07335 (ambt_07335)
Accession : YP_004466802.1
Strain : Alteromonas sp. SN2
Genome accession: NC_015554
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1652132 - 1652557 bp
Length : 426 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence : 
ATGAAAATAGGACAGTTAGCAGATAAAACAGGCCTAAGTATTCAAACTATTCGCTTTTATGAACGAAAGGCGTTGTTAGC
AGCACCACAGCGCACGCAATCGAATTATCGAAGTTATTCGGACGAAGCACTAAAGCAGTTGCTGTTTATTAAGCAATGCC
GCGCACTAGATATGACGATTGAAGAAATTAGTTTAGTACTAGAAACACGAACTAACCCAGAAAGCAGTTGCGAAAACGTC
AATGCAACAATAGACAAACATATTGATGATATTAAGCATCGAATATCTGAGCTAAACGCTCTACAGAAAACACTTAAATC
CATGCGAGCCGCTTGTAACGACGATAAGAAAATCAAGGAATGCGGTGTTTTGCACAGAATAGACAGCATTGTAGATTCGC
ACTGCCCTGCAAAACGTAACGACTGA

Protein sequence : 
MKIGQLADKTGLSIQTIRFYERKALLAAPQRTQSNYRSYSDEALKQLLFIKQCRALDMTIEEISLVLETRTNPESSCENV
NATIDKHIDDIKHRISELNALQKTLKSMRAACNDDKKIKECGVLHRIDSIVDSHCPAKRND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-25 47
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-25 47
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 8e-26 47
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 4e-25 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 3e-25 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 3e-25 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-25 46
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ambt_07335 YP_004466802.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 1e-23 45
ambt_07335 YP_004466802.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 3e-21 43