Gene Information

Name : Mahau_0744 (Mahau_0744)
Accession : YP_004462766.1
Strain : Mahella australiensis 50-1 BON
Genome accession: NC_015520
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 792819 - 793526 bp
Length : 708 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: tte:TTE1633 response regulator; PFAM: response regulator receiver; transcriptional regulator domain-con

DNA sequence :
ATGCCTAATGAAACTATTTTGGTAGTAGATGATGAAGCGCACATACTGGAGCTGATTCGCTTTAATTTAGAAAATGCGGG
GTATAAAGTCGAAGTTGCGGAGGATGGTGAAACGGCATTGAAATTTTGCCGGCAGCAGGTTCCGGACCTCATCATATTGG
ATATAATGTTGCCCGGTATAGACGGCTTGGAAGTGTGTAAAACGCTGAGAGCGTCGGTTGCTACTGCCAAAGTCCCGATC
ATTATGCTTACTGCTAAAGGAGAAGAGATAGATAAGGTAGTAGGCCTTGAAATAGGAGCTGACGATTATATTGCCAAGCC
GTTCGGTATAAGAGAATTAATAGCACGCGTTAAGGCTCTTTTAAGGAGAACAGAGAATAACGATATGGAGCCTAAAATAA
TAAAAGTAGGCGGTTTAACGATAGATACGTCAAAGTATGAGGTTTATAAAAACGGCAATAAATTAGATTTCACGCTTAAA
GAATTCGAATTATTGAAATTATTGGTTTTGAATCAGGGCAAGGTGCTGTCAAGGGATTATTTGCTAGATCAGGTGTGGGG
ATATGAATATTTCGGTGAAACCCGAACAGTAGATGTTCATATACGACATATAAGACAAAAATTAGGGGACGATATGGACG
AAGCTAAATATATCGAAACTATACGCGGCGTAGGCTATAAATTTATCGCTTCCGAGGAAGGCGAATAG

Protein sequence :
MPNETILVVDDEAHILELIRFNLENAGYKVEVAEDGETALKFCRQQVPDLIILDIMLPGIDGLEVCKTLRASVATAKVPI
IMLTAKGEEIDKVVGLEIGADDYIAKPFGIRELIARVKALLRRTENNDMEPKIIKVGGLTIDTSKYEVYKNGNKLDFTLK
EFELLKLLVLNQGKVLSRDYLLDQVWGYEYFGETRTVDVHIRHIRQKLGDDMDEAKYIETIRGVGYKFIASEEGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-30 42
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 3e-28 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-28 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-29 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-48 55
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-45 52
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-47 50
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-37 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-37 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-43 46
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-43 45
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-36 45
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 44
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-34 44
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-34 44
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-30 43
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 8e-28 43
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 7e-33 43
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-33 43
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-33 43
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 9e-31 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 2e-29 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 1e-32 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 6e-30 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-33 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-33 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-33 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-33 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 8e-30 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 8e-30 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-25 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-25 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 6e-28 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-29 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-28 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-34 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-28 42
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-34 41
Mahau_0744 YP_004462766.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-35 41