Gene Information

Name : MPTP_1312 (MPTP_1312)
Accession : YP_004456565.1
Strain : Melissococcus plutonius ATCC 35311
Genome accession: NC_015516
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1396017 - 1396706 bp
Length : 690 bp
Strand : -
Note : GO:0000156; GO:0003677

DNA sequence :
TTGGTTGTAGATGATGAAAAGCCAATTTCTGAAATTGTAAAATATAATTTAGTTAAAGAAGGCTATGAAGTATATACGGC
ATTTGATGGAGAAGAAGCTTTAGAAAAAGTAACCGAAGTAGAACCCGATTTAGTTTTATTGGATTTAATGTTACCTAAAA
TGGATGGATTAGAGGTAGCAAGAGAAATCAGAAAAACATACAATATGCCAATTATTATGGTAACAGCTAAGGATTCTGAA
ATTGATAAAGTATTAGGATTAGAGCTTGGTGCTGATGATTATGTAACAAAACCCTTTTCTAATCGTGAGTTGGTGGCACG
TGTCAAAGCAAACTTACGAAGAGAAGCATCAAGTGTTAAAGAGGAAGCAGGGAATCAATCCGAATTGACAATTGGAGATT
TAACGATTCATCCAGATGCCTATATGGTATCAAAAGCAGGTGAAAATATTGAGTTAACACATCGTGAATTTGAATTGCTT
TATTATTTGGCTAGGCATTTAGGCCAAGTGATGACAAGAGAGCACCTTTTACAAACTGTTTGGGGTTATGACTATTTTGG
AGATGTTCGAACGGTGGATGTTACGGTTAGACGTTTGCGTGAGAAGATAGAAGATAGTCCAAGCCATCCAGGTTACTTGG
TTACCCGTAGAGGTGTTGGCTACTATCTTAGAAATCCTGAACAGGAGTAA

Protein sequence :
MVVDDEKPISEIVKYNLVKEGYEVYTAFDGEEALEKVTEVEPDLVLLDLMLPKMDGLEVAREIRKTYNMPIIMVTAKDSE
IDKVLGLELGADDYVTKPFSNRELVARVKANLRREASSVKEEAGNQSELTIGDLTIHPDAYMVSKAGENIELTHREFELL
YYLARHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPGYLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MPTP_1312 YP_004456565.1 two-component response regulator NC_012469.1.7685629. Protein 4e-67 69
MPTP_1312 YP_004456565.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-51 56
MPTP_1312 YP_004456565.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_007622.3794472.p0 Protein 7e-52 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-51 55
MPTP_1312 YP_004456565.1 two-component response regulator HE999704.1.gene2815. Protein 2e-44 53
MPTP_1312 YP_004456565.1 two-component response regulator CP001918.1.gene5135. Protein 3e-30 50
MPTP_1312 YP_004456565.1 two-component response regulator NC_012469.1.7686381. Protein 1e-39 48
MPTP_1312 YP_004456565.1 two-component response regulator AE000516.2.gene3505. Protein 2e-35 47
MPTP_1312 YP_004456565.1 two-component response regulator CP004022.1.gene3215. Protein 1e-36 47
MPTP_1312 YP_004456565.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-38 46
MPTP_1312 YP_004456565.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-37 46
MPTP_1312 YP_004456565.1 two-component response regulator CP000034.1.gene3834. Protein 4e-32 46
MPTP_1312 YP_004456565.1 two-component response regulator CP000647.1.gene4257. Protein 2e-32 46
MPTP_1312 YP_004456565.1 two-component response regulator CP001138.1.gene4273. Protein 1e-32 46
MPTP_1312 YP_004456565.1 two-component response regulator NC_002695.1.915041.p Protein 4e-32 46
MPTP_1312 YP_004456565.1 two-component response regulator BAC0533 Protein 2e-32 46
MPTP_1312 YP_004456565.1 two-component response regulator AE016830.1.gene1681. Protein 4e-42 45
MPTP_1312 YP_004456565.1 two-component response regulator HE999704.1.gene1528. Protein 4e-30 44
MPTP_1312 YP_004456565.1 two-component response regulator CP001138.1.gene2239. Protein 5e-28 43
MPTP_1312 YP_004456565.1 two-component response regulator CP000034.1.gene2186. Protein 2e-28 43
MPTP_1312 YP_004456565.1 two-component response regulator NC_002695.1.916589.p Protein 1e-28 43
MPTP_1312 YP_004456565.1 two-component response regulator BAC0596 Protein 5e-28 43
MPTP_1312 YP_004456565.1 two-component response regulator BAC0039 Protein 2e-28 43
MPTP_1312 YP_004456565.1 two-component response regulator NC_005054.2598277.p0 Protein 4e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_014475.1.orf0.gen Protein 4e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator AF130997.1.orf0.gene Protein 2e-36 42
MPTP_1312 YP_004456565.1 two-component response regulator AM180355.1.gene1830. Protein 4e-38 42
MPTP_1312 YP_004456565.1 two-component response regulator AE015929.1.gene1106. Protein 1e-29 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-34 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_010410.6002989.p0 Protein 3e-27 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_010400.5986590.p0 Protein 2e-26 42
MPTP_1312 YP_004456565.1 two-component response regulator NC_011595.7057856.p0 Protein 3e-27 42
MPTP_1312 YP_004456565.1 two-component response regulator CP001918.1.gene3444. Protein 5e-27 42
MPTP_1312 YP_004456565.1 two-component response regulator CP000647.1.gene2531. Protein 8e-27 42
MPTP_1312 YP_004456565.1 two-component response regulator EU250284.1.orf4.gene Protein 6e-35 41
MPTP_1312 YP_004456565.1 two-component response regulator AF162694.1.orf4.gene Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MPTP_1312 YP_004456565.1 two-component response regulator VFG1386 Protein 5e-34 44
MPTP_1312 YP_004456565.1 two-component response regulator VFG1389 Protein 8e-30 44
MPTP_1312 YP_004456565.1 two-component response regulator VFG1702 Protein 4e-31 41