Gene Information

Name : Celf_0207 (Celf_0207)
Accession : YP_004451740.1
Strain : Cellulomonas fimi ATCC 484
Genome accession: NC_015514
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 231488 - 232066 bp
Length : 579 bp
Strand : -
Note : PFAM: stress protein; KEGG: sco:SCO0641 tellurium resistance protein

DNA sequence :
ATGGGCGTCTCCCTCGCGAAGGGCGGCAACGTCTCCCTGACCAAGGAGGCGCCGAACCTCACGAAGGCCCTCGTCGGGCT
CGGCTGGGACGTGCGGACGACGAGCGGCGACGGTTTCGACCTCGACGCGAGCGCCCTGCTCGTCGACGCGGGGGGCAAGG
TCCTCTCGGACCTGCACTTCGTCTTCTACAACAACCTCACGAGCCCCGACGGCTCCGTCACCCACACCGGTGACAACCGC
ACGGGCGAGGGCGACGGCGACGACGAGGCGCTCGTGGTGGACCTGACGCTCGTCCCCGCGACCGTCGAGAAGATCGTCTT
CCCGGTGTCGATCTACGACGCCGAGAAGCGCCGCCAGAGCTTCGGCCAGGTCCGCAACGCGTTCATCCGCGTCGTGAACC
AGGCGGACAACGAGGAGCTCGCCCGGTACGACCTGTCCGAGGACGCGTCGTCCGAGACCGCGATGATCTTCGGCGAGATC
TACCGCCACAGCGGCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGGTACGACACCGGCCTGGCCGGGATCGCCCGGGACTT
CGGCGTCCAGATCGGTTGA

Protein sequence :
MGVSLAKGGNVSLTKEAPNLTKALVGLGWDVRTTSGDGFDLDASALLVDAGGKVLSDLHFVFYNNLTSPDGSVTHTGDNR
TGEGDGDDEALVVDLTLVPATVEKIVFPVSIYDAEKRRQSFGQVRNAFIRVVNQADNEELARYDLSEDASSETAMIFGEI
YRHSGEWKFRAVGQGYDTGLAGIARDFGVQIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-61 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-60 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-54 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celf_0207 YP_004451740.1 stress protein BAC0390 Protein 4e-61 67
Celf_0207 YP_004451740.1 stress protein BAC0389 Protein 6e-61 66
Celf_0207 YP_004451740.1 stress protein BAC0392 Protein 5e-27 42