Gene Information

Name : Celf_0205 (Celf_0205)
Accession : YP_004451738.1
Strain : Cellulomonas fimi ATCC 484
Genome accession: NC_015514
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 229608 - 230186 bp
Length : 579 bp
Strand : -
Note : PFAM: stress protein; KEGG: tcu:Tcur_3190 stress protein

DNA sequence :
GTGTCCGTCAACCTCACCAAGGGCCAGACCGTCTCGCTGACCAAGTCCGACGGTGGAAGCCTCACGCAGGTCCGCATGGG
CCTCGGCTGGGACGCCATCAAGGTCAAGGGGCTGTTCGGCCGGGCGAAGGAGAAGGCCGTCGACCTCGACGCGTCCGCCC
TGCTCTACGACGCGTCCGGCGTGCTGGTGGACCAGGTCTGGTTCAGCCAGCTCACGAGCAAGGACGGCGCCGTGCAGCAC
ACCGGCGACAACCGCACCGGCGCGGGCGACGGCGACGACGAGTCGATCCGCGTCGCCCTGACCGCCGTGAACCCGGCCGT
GCACACCCTGGTGTTCGTCGTGAACAGCTACACCGGTGAGACGTTCTCCTCGATCGAGAACGCGTTCTGCCGCCTCATCG
ACGAGACCACGGGCCAGGAGGTCGCGCGCTACGACCTGTCCGGCTCGGGCCCGCACACCGCGCAGATCATGGCGAAGGTG
TCCCGCGTCGGCTCGGGGTGGGCGATGACGGCCCTCGGGGTGCGCGCGAACGGCCGCACCATCAAGGACATGTCGGCGGC
GGTCACGCAGGTGCTGTGA

Protein sequence :
MSVNLTKGQTVSLTKSDGGSLTQVRMGLGWDAIKVKGLFGRAKEKAVDLDASALLYDASGVLVDQVWFSQLTSKDGAVQH
TGDNRTGAGDGDDESIRVALTAVNPAVHTLVFVVNSYTGETFSSIENAFCRLIDETTGQEVARYDLSGSGPHTAQIMAKV
SRVGSGWAMTALGVRANGRTIKDMSAAVTQVL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-36 47
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-36 47
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-43 45
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-25 42
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-23 41
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-24 41
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-23 41
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celf_0205 YP_004451738.1 stress protein BAC0392 Protein 2e-36 47
Celf_0205 YP_004451738.1 stress protein BAC0390 Protein 3e-24 42
Celf_0205 YP_004451738.1 stress protein BAC0389 Protein 7e-25 41