|
Name : AGROH133_12123 (AGROH133_12123) Accession : YP_004443955.1 Strain : Genome accession: NC_015508 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 1238625 - 1238750 bp Length : 126 bp Strand : + Note : smallest protein in the large subunit; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc ion; the proteins in this group do not have the motif DNA sequence : ATGAAAATCAAGAATTCGCTTAAAGCGCTTAAGGCCCGTCATCGCGATAACCGCCTGGTTCGCCGCAAGGGCCGCGTCTA CATCATCAACAAGCAGAACCCGCGCTTCAAGGCTCGTCAGGGCTGA Protein sequence : MKIKNSLKALKARHRDNRLVRRKGRVYIINKQNPRFKARQG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 1e-06 | 57 |
