Gene Information

Name : Glaag_0508 (Glaag_0508)
Accession : YP_004432739.1
Strain : Glaciecola sp. 4H-3-7+YE-5
Genome accession: NC_015497
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 571556 - 571885 bp
Length : 330 bp
Strand : -
Note : PFAM: small multidrug resistance protein; KEGG: svo:SVI_1721 quaternary ammonium compound-resistance protein QacE

DNA sequence :
ATGGGATATTGGTATTTGTCTGTTGCTATCGTGGCAGAAGTGATTGGTACAATGGCCCTAAAGGCCTCGAATGGTTTTTC
CCACCTAGTCTCTAGTACAATTTGTGTTGTGAGCTATGCAACAACGTTTTACTTTCTTTCTTTGGTGTTAAAAACCGTCC
CCGTAGGGGTCGCCTACGCAATTTGGGCGGGTATGGGGATTGTCTTGATCGCGGTTATCAGTGCCGTGATCTATAAAGAG
CTACCTGACCTGCCTGCCGTGCTCGGTATGGGCTTAATCCTAAGTGGCGTGCTTGTGATCAATATATTTTCGAAAACCTC
TGGCCATTAA

Protein sequence :
MGYWYLSVAIVAEVIGTMALKASNGFSHLVSSTICVVSYATTFYFLSLVLKTVPVGVAYAIWAGMGIVLIAVISAVIYKE
LPDLPAVLGMGLILSGVLVINIFSKTSGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-19 48
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 4e-19 48
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-19 48
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-19 48
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-19 48
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-19 48
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-19 48
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-19 48
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-19 48
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-19 48
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 4e-19 48
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-19 48
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-19 48
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-19 48
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-19 48
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-19 48
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-19 48
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-19 48
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-19 48
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 4e-19 48
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-16 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0377 Protein 6e-23 55
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0324 Protein 1e-22 54
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0002 Protein 2e-23 54
Glaag_0508 YP_004432739.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 2e-23 54
Glaag_0508 YP_004432739.1 small multidrug resistance protein CP004022.1.gene1549. Protein 3e-21 53
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0322 Protein 6e-23 52
Glaag_0508 YP_004432739.1 small multidrug resistance protein NC_002695.1.913273.p Protein 1e-17 49
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0323 Protein 1e-19 48
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0329 Protein 7e-16 48
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0150 Protein 2e-17 47
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0192 Protein 5e-17 47
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0327 Protein 2e-14 47
Glaag_0508 YP_004432739.1 small multidrug resistance protein CP001138.1.gene1489. Protein 3e-19 46
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0326 Protein 7e-15 45
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0321 Protein 2e-18 43
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0325 Protein 3e-14 42
Glaag_0508 YP_004432739.1 small multidrug resistance protein AE000516.2.gene3301. Protein 1e-07 42
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0249 Protein 1e-07 42
Glaag_0508 YP_004432739.1 small multidrug resistance protein BAC0139 Protein 3e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glaag_0508 YP_004432739.1 small multidrug resistance protein VFG1586 Protein 5e-17 44