Gene Information

Name : Glaag_0410 (Glaag_0410)
Accession : YP_004432644.1
Strain : Glaciecola sp. 4H-3-7+YE-5
Genome accession: NC_015497
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 457241 - 457549 bp
Length : 309 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: psp:PSPPH_3740 ISPsy24, transposase orfA

DNA sequence :
ATGAAGAGACAAAGACGTACGTTTTCAGCAGAATTCAAGTTAGAAGCAGCAAACCTGGTCTTGCAGCAAGGTTACTCAAT
CCCTGAGGCGGCAAGAGCATTAGATATTGGCGAAACAGCAGTTCGCCGCTGGGTGACGCAATTGCAAGAAGAGCATAATG
GCGGTACACCTAAGTCCAAAGCCCTGACACCTGAACAGCAAAAAATCCAAGAGCTTGAAGCAAGAGTAAGCCGTTTAGAG
CGGGAAAAATCTATTTTAAAAAAGGCTACAGCTCTCTTGATGTCGGAAGAGCACGAACGTACGCGCTGA

Protein sequence :
MKRQRRTFSAEFKLEAANLVLQQGYSIPEAARALDIGETAVRRWVTQLQEEHNGGTPKSKALTPEQQKIQELEARVSRLE
REKSILKKATALLMSEEHERTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 8e-32 73
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-24 59
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-24 59
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-24 59
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-24 59
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-24 59
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-24 59
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-24 59
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-24 59
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-22 52
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-22 52
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-20 51
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-21 50
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-18 50
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 8e-22 49
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-22 49
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-20 48
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-20 48
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-20 48
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-20 48
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 2e-16 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 4e-13 43
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-17 42
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glaag_0410 YP_004432644.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-24 59
Glaag_0410 YP_004432644.1 transposase IS3/IS911 family protein VFG1485 Protein 1e-22 52
Glaag_0410 YP_004432644.1 transposase IS3/IS911 family protein VFG1553 Protein 1e-20 51
Glaag_0410 YP_004432644.1 transposase IS3/IS911 family protein VFG0784 Protein 8e-21 48
Glaag_0410 YP_004432644.1 transposase IS3/IS911 family protein VFG1566 Protein 2e-13 43