Gene Information

Name : UMN179_00816 (UMN179_00816)
Accession : YP_004419743.1
Strain : Gallibacterium anatis UMN179
Genome accession: NC_015460
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 876284 - 876589 bp
Length : 306 bp
Strand : +
Note : -

DNA sequence :
ATGAGAAGAACATTTAGCCCGGACTACAAAGTTGCCGCGGTAAAATTAGTCACCGAGCAAGGTTATTCTGTTGCCCAAGC
CTGTTCGGAATTAGGGATAGGCGAAACGGCATTACGTCGTTGGATAAAACAAGTCCAAGCAGAAAAACAAGGCTATGTAT
TGCCCGGAACGAAGCCCTTATCACCGGAACAGCAACGGATACGAGAGCTTGAACAACGCATTAAAATTCTCGAAGAGGAT
AAAGAAATCTTAAAAAAGGCTACCGCGATTTTTATGTCACTCGAGCACAACGCTACCAAGCGGTAA

Protein sequence :
MRRTFSPDYKVAAVKLVTEQGYSVAQACSELGIGETALRRWIKQVQAEKQGYVLPGTKPLSPEQQRIRELEQRIKILEED
KEILKKATAIFMSLEHNATKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 7e-18 57
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 5e-12 45
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-13 45
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-13 45
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-13 45
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-13 45
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-13 45
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-13 45
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-13 45
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-13 45
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-13 45
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 7e-14 45
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-12 44
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-12 44
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMN179_00816 YP_004419743.1 putative transposase VFG1553 Protein 2e-12 45
UMN179_00816 YP_004419743.1 putative transposase VFG1123 Protein 2e-13 45
UMN179_00816 YP_004419743.1 putative transposase VFG1485 Protein 9e-13 44