Gene Information

Name : PT7_2217 (PT7_2217)
Accession : YP_004417381.1
Strain : Pusillimonas sp. T7-7
Genome accession: NC_015458
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2373446 - 2373790 bp
Length : 345 bp
Strand : +
Note : -

DNA sequence :
ATGATCGGCTTGCCGACAGGAACGCGGGTGTGGCTGGCGGCTGGCGCCACCGACATGCGCCGAGGCTTTGATGGCCTGGC
CGCCATCGTACAGGCCAAGCTTGAAGAAGACCCGTTCAGTGGTCATGTGTTCGTCTTCCGGGGCCGCAAGGGTGATCGCA
TCAAGGTGCTGTGGTGGAGCGGCGACGGCATGTGCCTGCTGGCCAAGCGCCTTGAACATGGTCGTTTCGTGTGGCCCGGC
GCCGAATCGGGCGTGGTACATTTGACGCCAGCGCAGCTGTCAATGCTGCTTGAAGGTATTGATTGGCGCCGCCCGACGCG
CACCCGCAAACCGACCCAGGTTTAG

Protein sequence :
MIGLPTGTRVWLAAGATDMRRGFDGLAAIVQAKLEEDPFSGHVFVFRGRKGDRIKVLWWSGDGMCLLAKRLEHGRFVWPG
AESGVVHLTPAQLSMLLEGIDWRRPTRTRKPTQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 7e-34 69
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-35 69
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-35 69
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-33 68
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-34 68
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-34 68
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-34 68
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-34 68
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-34 68
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-34 68
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-34 68
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-33 68
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-34 68
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-36 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-36 67
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-34 67
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-34 67
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-26 66
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-36 66
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-34 66
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-33 58
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-33 58
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-31 56
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-31 56
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-32 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PT7_2217 YP_004417381.1 hypothetical protein VFG1698 Protein 2e-35 69
PT7_2217 YP_004417381.1 hypothetical protein VFG1709 Protein 1e-34 68
PT7_2217 YP_004417381.1 hypothetical protein VFG0792 Protein 1e-34 68
PT7_2217 YP_004417381.1 hypothetical protein VFG1517 Protein 7e-27 66
PT7_2217 YP_004417381.1 hypothetical protein VFG1665 Protein 3e-36 66
PT7_2217 YP_004417381.1 hypothetical protein VFG1052 Protein 2e-34 66
PT7_2217 YP_004417381.1 hypothetical protein VFG1737 Protein 3e-33 56