Gene Information

Name : Selsp_0097 (Selsp_0097)
Accession : YP_004412536.1
Strain : Selenomonas sputigena ATCC 35185
Genome accession: NC_015437
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 110900 - 111478 bp
Length : 579 bp
Strand : +
Note : COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: ctc:CTC02234 tellurium resistance protein TerD; PFAM: Bacterial stress protein; SPTR: Tellurium resistanc

DNA sequence :
ATGGCAATCAGTTTGAAAAAGGGACAGAAAGTTGATCTGACGAAGGGCAATCCGGGTCTCTCGAAGCTCCTGATCGGCCT
CGGCTGGGACACGAACAAGTACGACGGCGGCTCTGACTTCGACCTCGACGCCTCGGCGTTCCTTCTCGGACCGAACGAGA
AGGTCACGAGCGATGCGGACTTCGTTTTCTATGGCAACCTCAAGCACGCATCGGGCGCCGTCGAGCATACGGGCGACAAC
CTCACGGGCGAGGGCGAGGGCGACGACGAGCAGATCAAGGTCGATCTCTCGAAGGTGCCGGCTTCCATCGACAAGATCGA
TTTCACGGTCACGATCTACGAGGCCGATGAGCGCAAGCAGAACTTCGGCCAGGTGTCGAACGCCTTCATTCGCGTTGTCA
ACGAGGCGACGGGAGAGGAACTCATCCGCTTCGACCTCGGCGAGGACTTCTCCATCGAGACGGCGGTCGTCGTCGGCAGG
CTCTACCGCCAGGGTGCGGAGTGGAAGTTCAATGCCATCGGCGCGGGCTACAGCGGCGGCCTCGGCGCACTCGGCAAGGC
TTACGGCGTTAACGTATAA

Protein sequence :
MAISLKKGQKVDLTKGNPGLSKLLIGLGWDTNKYDGGSDFDLDASAFLLGPNEKVTSDADFVFYGNLKHASGAVEHTGDN
LTGEGEGDDEQIKVDLSKVPASIDKIDFTVTIYEADERKQNFGQVSNAFIRVVNEATGEELIRFDLGEDFSIETAVVVGR
LYRQGAEWKFNAIGAGYSGGLGALGKAYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-50 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-44 58
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-44 58
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-44 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-46 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-46 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-45 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-41 54
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-30 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-27 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_0097 YP_004412536.1 stress protein BAC0390 Protein 7e-47 61
Selsp_0097 YP_004412536.1 stress protein BAC0389 Protein 2e-46 58
Selsp_0097 YP_004412536.1 stress protein BAC0392 Protein 2e-26 41