Gene Information

Name : Selsp_0096 (Selsp_0096)
Accession : YP_004412535.1
Strain : Selenomonas sputigena ATCC 35185
Genome accession: NC_015437
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 110138 - 110743 bp
Length : 606 bp
Strand : +
Note : COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR019303:IPR003325; KEGG: drm:Dred_0337 stress protein; PFAM: Bacterial stress protein; Tellurium resistance; SPTR: Tellu

DNA sequence :
ATGGGCGTGAATCTGCAAAAAGGACAGAAGGTAAACTTGAAGAAGTCGGACGGTCAGGCGCTCTCGCGCATCCGCATCGG
ACTCGGCTGGGATCCCGTCGAGCAGAAGAAAGGCGGACTTTTCGGCTCGATCTTCGGCGGTTCTGCGCCCGACATCGACT
GCGACGCGAGCGTGATTGTCTGCAAGGGCGGCCGCCTCTCGGGGAAGAAGGACGTCGTTTACTTCGGCAACCTCAAGCAT
CCGTCTGGTGCGATCGTCCATACGGGCGATAACCTCACGGGAGAGGGCGAGGGCGACGATGAGCAGATCCTCGTCGATCT
TACCGCTGTGCCCGCAGATTATGACAAGCTCGTCTTCGTCGTCAACATCTACGACTGCGAGTCGAGAAAGCAGGACTTCG
GCATGATCGCGAACGCCTTCATCCGTATATGCGACGAGCGGACAGGCGAGGAGTTTTGCCGCTACAACCTCTCGGAGAGC
TACGCAGGCATGACGGCGATGATCTTCGGCGAGATCTACCGCTATAACGGCGAGTGGAAGTTCAATGCCATCGGGCAGGG
CACGAAGGACAAGGGTCTGAACGAGCTGGCGCGGCGCTATCAGTAA

Protein sequence :
MGVNLQKGQKVNLKKSDGQALSRIRIGLGWDPVEQKKGGLFGSIFGGSAPDIDCDASVIVCKGGRLSGKKDVVYFGNLKH
PSGAIVHTGDNLTGEGEGDDEQILVDLTAVPADYDKLVFVVNIYDCESRKQDFGMIANAFIRICDERTGEEFCRYNLSES
YAGMTAMIFGEIYRYNGEWKFNAIGQGTKDKGLNELARRYQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-37 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-36 44
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-36 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-36 44
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-31 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-34 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-34 43
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-34 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 9e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_0096 YP_004412535.1 stress protein BAC0390 Protein 2e-35 43
Selsp_0096 YP_004412535.1 stress protein BAC0389 Protein 3e-34 43