Gene Information

Name : Selsp_0099 (Selsp_0099)
Accession : YP_004412538.1
Strain : Selenomonas sputigena ATCC 35185
Genome accession: NC_015437
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 112278 - 112862 bp
Length : 585 bp
Strand : +
Note : COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cno:NT01CX_0666 stress protein; PFAM: Bacterial stress protein; SPTR: Tellurium resistance protein TerD;

DNA sequence : 
ATGGCGGTGAATCTTTCCAAGGGACAGCGCGTGAGTCTTGACAAGGGCATGACGATGGCGCTCGTCGGCCTCGGCTGGGA
CGTCAACCAGTACGACGGCGGCGCGGACTTCGACCTCGACGCCTCGGCGTTCCTCTTGGGCGCGAACGGCAAAGTGCGAA
AGGACGAGGACTTCATCTTCTACGGCAACCTCGACAGTCAGGACGGCTCGGTGCATCATACGGGCGACAACCTCACGGGC
GAGGGCGAGGGCGACGACGAGGTTCTGACGATCGACTTTACGAAAGTGCCGGCGGACGTCGACAAGATCGCCATCACCGT
GACGATTTACGAGGCGCAGGTGCGCAAGCAGAACTTCGGACAGGTGTCGAACGCCTACGTGCGCGTCGCGCGCATGGCGA
ACGCGCAGGATATGCAGGGCACGGAGGTTCTGCGCTTCGATCTCATGGAGGAGTTCTCCGTCGAGACGGCGCTCGTCGTC
TGCGAGATCTATCGGCACAACGGCGAATGGAAGTTCAACGCGGTCGGCGCGGGCTATCAGGGCGGCTTGGAAGCCCTTTG
CCGCGCGTACGGCGTGAATGTCTGA

Protein sequence : 
MAVNLSKGQRVSLDKGMTMALVGLGWDVNQYDGGADFDLDASAFLLGANGKVRKDEDFIFYGNLDSQDGSVHHTGDNLTG
EGEGDDEVLTIDFTKVPADVDKIAITVTIYEAQVRKQNFGQVSNAYVRVARMANAQDMQGTEVLRFDLMEEFSVETALVV
CEIYRHNGEWKFNAVGAGYQGGLEALCRAYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-49 60
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-50 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-43 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-43 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-44 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-41 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_0099 YP_004412538.1 stress protein BAC0389 Protein 2e-49 61
Selsp_0099 YP_004412538.1 stress protein BAC0390 Protein 7e-46 57