Gene Information

Name : Lbuc_0045 (Lbuc_0045)
Accession : YP_004397399.1
Strain : Lactobacillus buchneri NRRL B-30929
Genome accession: NC_015428
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 44166 - 44882 bp
Length : 717 bp
Strand : +
Note : KEGG: lbr:LVIS_0029 DNA-binding response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction resp

DNA sequence :
ATGGCAAAAAAGATACTGGTTGTCGATGACGAAAAACCAATCGTCGACATTGAAAAATTTAATTTAACTAAAGAAGGCTA
CGAAGTCTCAGTAGCTTATGATGGTGAAGAAGCATTGCAGCAAGTCAAAGACGTTGATCCGGATTTAATTATCTTGGATC
TGATGTTACCCAAAGTTGATGGCCTGGAAGTTGCCAGGGAAGTCCGTAAGACTAAGGACACCCCAATCATTATGGTGACT
GCCAAAGATTCCGAGTTGGATAAGGTTCTTGGCTTGGAGCTTGGGGCTGATGATTATGTGACCAAGCCATTCTCGAACCG
AGAATTAGTCGCCCGTGTGAAGGCTAACCTACGCCGTCAGGGGACCAATAGCAGTTCCAATAACGAAGAAGACGAAAATA
AAGATATCAAGATCGGTGATTTGGTGATTCATCCGGAAGCTTACTCAGTTTCCAAACGGGGTGAAAATATTGAATTGACC
CACCGTGAATTTGAATTGTTGCATTATTTGGCCCAACACATTGGCCAAGTCATGACCCGGGAGCATTTACTGCAGACCGT
TTGGGGCTATGATTATTTTGGTGACGTGAGAACCGTTGATGTCACTGTCCGGCGTCTCCGTGAAAAAGTTGAGGACAGCC
CCAGTCATCCAACCTGGCTGGTAACCCGTCGTGGGGTAGGTTATTACCTGCGCAACCCAGAAAGTGATCAAGCATAA

Protein sequence :
MAKKILVVDDEKPIVDIEKFNLTKEGYEVSVAYDGEEALQQVKDVDPDLIILDLMLPKVDGLEVAREVRKTKDTPIIMVT
AKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQGTNSSSNNEEDENKDIKIGDLVIHPEAYSVSKRGENIELT
HREFELLHYLAQHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDSPSHPTWLVTRRGVGYYLRNPESDQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-57 69
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-42 55
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-38 52
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-37 47
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-33 47
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-24 47
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-27 45
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 5e-25 44
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-25 44
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator BAC0533 Protein 4e-28 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-28 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 4e-28 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-28 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-29 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-23 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-26 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 7e-28 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 7e-28 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-23 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator BAC0039 Protein 8e-22 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 8e-22 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-21 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-26 41
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-27 41
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-20 41
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-21 41
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-20 41
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-24 43
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-24 42
Lbuc_0045 YP_004397399.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-25 41