Gene Information

Name : Alide2_0684 (Alide2_0684)
Accession : YP_004386616.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 706678 - 707388 bp
Length : 711 bp
Strand : +
Note : KEGG: pol:Bpro_0543 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
ATGGACACCCCCAAACGCATCCTGATCGTCGAAGACGATGACAGCATCGCCGAGCTGCTGCGCATGCATCTGAGCGACGA
AGGCTACGACGTCGAGCGCGTGGCCGATGGCAGGCTGGGCCTTGCCGCCGTGGAGCGTGGAGGCTGGCATGCGCTGGTGC
TCGACCTGATGCTGCCCGGGGTGGATGGCCTGGAGATCTGCAGGCGGGCGCGGGCCATGACTTACTACGTTCCCATCATC
ATCACCAGCGCCCGTTCGAGCGAGGTGCATCGCATCCTGGGGCTGGAGCTGGGGGCCGACGACTACCTGGCCAAGCCGTT
CTCCGTCATGGAGCTCGTCGCGCGGGTGCGCGCGCTCCTGCGGCGCAGCGAGGCGCTCGCGCGTAATGCCAAGCTCGAGG
CCGGCGTGCTCTCGCTGGGGGGCCTGAGCATCGACCCGATCGCGCGCGAGGCCCGGGTGGACGGCCAGTCCGTCGAACTT
ACGCCGCGCGAGTTCGACCTGCTGTATTTCTTTGCCCGCCAGCCGGGCAAGGTGTTCTCGCGGCTCGATCTACTCAACCA
GGTCTGGGGCTATCGGCATGACGGCTATGAGCACACGGTGAATACGCACATCAACCGGCTGCGGATCAAGATCGAAAGGA
ACCCGGCCGACCCCAAGCGCATCCTCACCGTCTGGGGTCGCGGCTACAAACTCGCGGAGGATGCCCTGTGA

Protein sequence :
MDTPKRILIVEDDDSIAELLRMHLSDEGYDVERVADGRLGLAAVERGGWHALVLDLMLPGVDGLEICRRARAMTYYVPII
ITSARSSEVHRILGLELGADDYLAKPFSVMELVARVRALLRRSEALARNAKLEAGVLSLGGLSIDPIAREARVDGQSVEL
TPREFDLLYFFARQPGKVFSRLDLLNQVWGYRHDGYEHTVNTHINRLRIKIERNPADPKRILTVWGRGYKLAEDAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-62 59
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-61 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-39 45
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-35 43
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-33 43
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-35 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-23 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-23 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-20 42
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-25 41
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-62 59
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-61 58
Alide2_0684 YP_004386616.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-22 42