Gene Information

Name : Alide2_3381 (Alide2_3381)
Accession : YP_004389234.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3519645 - 3520067 bp
Length : 423 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; KEGG: net:Neut_2571 putative transcriptional regulator MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGCAAACTATTTTTGAGAATCTGACCATTGGCGCTTTTGCCAAGGCGGCCGGGGTCAATGTGGAGACCATCCGCTTCTA
TCAGCGCAAAGGCTTGTTGCCCGAGCCGGACAAGCCCTATGGCAGCATTCGCCGGTATGGCGAAGCCGACGTGGCGCGGG
TACGGTTTGTGAAATCATCCCAGCGGCTGGGCTTCAGCCTGGACGAAGTTGCCGAACTGCTCAGGTTGGACGATGGCACG
CACTGCGATGAAGCCAGCCGCTTGGCGGAGCACAAGCTCCAGGACGTACGCGAAAAGATGGCTGATTTGGCGCGCATGGA
AGCCGCGCTATCCGCATTGGTGTGCGCCTGTCATGCGCGGAAGGGGAATGTTTCCTGTCCGCTGATTGCTTCGTTGCAAG
AGAACCGGATAGTGCCAGCATGA

Protein sequence :
MQTIFENLTIGAFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVARVRFVKSSQRLGFSLDEVAELLRLDDGT
HCDEASRLAEHKLQDVREKMADLARMEAALSALVCACHARKGNVSCPLIASLQENRIVPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-56 88
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-56 88
merR ACK44535.1 MerR Not tested SGI1 Protein 5e-54 87
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 5e-54 87
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 7e-54 87
merR AFG30124.1 MerR Not tested PAGI-2 Protein 5e-54 87
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-53 86
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-53 86
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-48 79
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-45 74
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 8e-28 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0688 Protein 1e-55 87
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0686 Protein 4e-54 87
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0689 Protein 9e-54 86
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0683 Protein 2e-55 85
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0684 Protein 2e-55 85
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0232 Protein 2e-54 84
Alide2_3381 YP_004389234.1 MerR family transcriptional regulator BAC0687 Protein 2e-54 84