Gene Information

Name : Alide2_3379 (Alide2_3379)
Accession : YP_004389232.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 3518935 - 3519210 bp
Length : 276 bp
Strand : -
Note : KEGG: shn:Shewana3_4343 mercuric transport protein periplasmic component; TIGRFAM: Mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGAAAAAACGGTTTGCCGCCCTCGCTCTCGTCGCCGTCGCTGCCCCAGCGTGGGCCGCCACCCAAACCGTCAAGCTGTC
GGTGCCTGGCATGACTTGCGCAACCTGTCCGATCACGGTCAAGAAAGCGCTCTCCAAGGTCGATGGCGTGAGCAAGGCCG
ACGTGAACTTCGATAAGCGCGAAGCCGTCGTCACCTTCGACGACGCCAAGACCAGCGTCCAGAAGCTGACCAAAGCGACC
GAAGACGCGGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKRFAALALVAVAAPAWAATQTVKLSVPGMTCATCPITVKKALSKVDGVSKADVNFDKREAVVTFDDAKTSVQKLTKAT
EDAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 6e-24 86
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 4e-24 86
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-24 83
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-24 83
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-24 83
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-24 83
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-24 83
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-24 83
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 7e-24 79
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 7e-22 78

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_3379 YP_004389232.1 mercuric transport periplasmic protein BAC0679 Protein 2e-23 86
Alide2_3379 YP_004389232.1 mercuric transport periplasmic protein BAC0678 Protein 5e-24 83
Alide2_3379 YP_004389232.1 mercuric transport periplasmic protein BAC0231 Protein 5e-24 82
Alide2_3379 YP_004389232.1 mercuric transport periplasmic protein BAC0675 Protein 3e-21 74
Alide2_3379 YP_004389232.1 mercuric transport periplasmic protein BAC0674 Protein 2e-17 61