Name : Alide2_2164 (Alide2_2164) Accession : YP_004388051.1 Strain : Alicycliphilus denitrificans K601 Genome accession: NC_015422 Putative virulence/resistance : Resistance Product : mercuric transport periplasmic protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 2265425 - 2265703 bp Length : 279 bp Strand : - Note : KEGG: psa:PST_3433 periplasmic transport protein; MerP; TIGRFAM: Mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGCGCAAATCAGTCGTATCGCTGCTCGTCGCGCTGTCGCCGTTCGCTGCCCTGGCCGCAACGCCCCAGACGGCGACGCT CAATGTACAGAACATGACCTGCGAGCTGTGCCCGGTCACGGTGAAGAAGTCTCTGGAGAAGGTGCCTGGCGTTAGCCAGG TCAGGATCGACTTCGCCAAGAAGACGGCGACCGTCACGTTCGATGCAGAACAGGCCCAAGTCTCGACGCTCGTGAAGGCG ACCACCGACGCGGGCTACCCTACGACGGTGCACAAATGA Protein sequence : MRKSVVSLLVALSPFAALAATPQTATLNVQNMTCELCPVTVKKSLEKVPGVSQVRIDFAKKTATVTFDAEQAQVSTLVKA TTDAGYPTTVHK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-13 | 56 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-13 | 56 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-13 | 56 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-13 | 56 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-13 | 56 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-13 | 56 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-12 | 50 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-12 | 50 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 7e-13 | 48 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Alide2_2164 | YP_004388051.1 | mercuric transport periplasmic protein | BAC0231 | Protein | 1e-13 | 53 |
Alide2_2164 | YP_004388051.1 | mercuric transport periplasmic protein | BAC0675 | Protein | 2e-13 | 53 |
Alide2_2164 | YP_004388051.1 | mercuric transport periplasmic protein | BAC0679 | Protein | 2e-13 | 51 |
Alide2_2164 | YP_004388051.1 | mercuric transport periplasmic protein | BAC0678 | Protein | 5e-13 | 51 |
Alide2_2164 | YP_004388051.1 | mercuric transport periplasmic protein | BAC0674 | Protein | 6e-12 | 47 |