Gene Information

Name : Alide2_2164 (Alide2_2164)
Accession : YP_004388051.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2265425 - 2265703 bp
Length : 279 bp
Strand : -
Note : KEGG: psa:PST_3433 periplasmic transport protein; MerP; TIGRFAM: Mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGCGCAAATCAGTCGTATCGCTGCTCGTCGCGCTGTCGCCGTTCGCTGCCCTGGCCGCAACGCCCCAGACGGCGACGCT
CAATGTACAGAACATGACCTGCGAGCTGTGCCCGGTCACGGTGAAGAAGTCTCTGGAGAAGGTGCCTGGCGTTAGCCAGG
TCAGGATCGACTTCGCCAAGAAGACGGCGACCGTCACGTTCGATGCAGAACAGGCCCAAGTCTCGACGCTCGTGAAGGCG
ACCACCGACGCGGGCTACCCTACGACGGTGCACAAATGA

Protein sequence :
MRKSVVSLLVALSPFAALAATPQTATLNVQNMTCELCPVTVKKSLEKVPGVSQVRIDFAKKTATVTFDAEQAQVSTLVKA
TTDAGYPTTVHK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-13 56
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-13 56
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-13 56
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-13 56
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-13 56
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-13 56
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-12 50
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-12 50
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 7e-13 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_2164 YP_004388051.1 mercuric transport periplasmic protein BAC0675 Protein 2e-13 53
Alide2_2164 YP_004388051.1 mercuric transport periplasmic protein BAC0231 Protein 1e-13 53
Alide2_2164 YP_004388051.1 mercuric transport periplasmic protein BAC0678 Protein 5e-13 51
Alide2_2164 YP_004388051.1 mercuric transport periplasmic protein BAC0679 Protein 2e-13 51
Alide2_2164 YP_004388051.1 mercuric transport periplasmic protein BAC0674 Protein 6e-12 47