Gene Information

Name : Alide2_1948 (Alide2_1948)
Accession : YP_004387841.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Resistance
Product : mercuric resistance transcriptional repressor protein MerD
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2048001 - 2048366 bp
Length : 366 bp
Strand : -
Note : TIGRFAM: Mercuric resistence transcriptional repressor protein MerD; PFAM: HTH transcriptional regulator, MerR; KEGG: bxe:Bxe_C1212 transcriptional regulator MerD; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGAACGCCTACACGGTGTCCCGGTTGGCCTTTGATGCCGGGGTGAGTGTGCATATCGTGCGCGATTACCTGCTGCGTGG
ATTGCTGCGGCCAGTCGCCTGCACCACGGGTGGCTACGGCCTGTTCGATGACGCCGCCTTGCAGCGACTGTGCTTCGTGC
GGGCCGCCTTCGAGGCGGGCATCGGCCTCGGCGCATTGGCGCGGCTGTGCCGGGCGCTGGATGCGGCGAACTGCGATGAA
ACTGCCGCGCAGCTTGCTGTGCTGCGTCAGTTCGTCGAACGCCGGCGCGAAGCGTTGGCCAATCTGGAAGTGCAGTTGGC
CGCCATGCCGACCGCGCCGGCACAGCATGCGGAGAGTTTGCCATGA

Protein sequence :
MNAYTVSRLAFDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDAALQRLCFVRAAFEAGIGLGALARLCRALDAANCDE
TAAQLAVLRQFVERRREALANLEVQLAAMPTAPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ABQ57370.1 MerD Not tested SGI1 Protein 9e-34 91
merD AGK07020.1 MerD Not tested SGI1 Protein 4e-34 91
merD AGK07078.1 MerD Not tested SGI1 Protein 4e-34 91
merD ACN81004.1 MerD Not tested AbaR5 Protein 4e-34 88
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 7e-34 88
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 1e-27 81
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 1e-27 81
merD AFG30119.1 MerD Not tested PAGI-2 Protein 1e-27 81
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 2e-27 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_1948 YP_004387841.1 mercuric resistance transcriptional repressor protein MerD BAC0667 Protein 4e-40 99
Alide2_1948 YP_004387841.1 mercuric resistance transcriptional repressor protein MerD BAC0669 Protein 8e-39 93
Alide2_1948 YP_004387841.1 mercuric resistance transcriptional repressor protein MerD BAC0666 Protein 3e-34 91
Alide2_1948 YP_004387841.1 mercuric resistance transcriptional repressor protein MerD BAC0227 Protein 4e-34 91
Alide2_1948 YP_004387841.1 mercuric resistance transcriptional repressor protein MerD BAC0668 Protein 2e-34 91
Alide2_1948 YP_004387841.1 mercuric resistance transcriptional repressor protein MerD BAC0665 Protein 5e-35 90