Gene Information

Name : MDS_3430 (MDS_3430)
Accession : YP_004381213.1
Strain : Pseudomonas mendocina NK-01
Genome accession: NC_015410
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3793862 - 3794587 bp
Length : 726 bp
Strand : -
Note : -

DNA sequence :
GTGGAACAAGAAGCGTGGCAGATTCTGATCGTCGAGGATGACCAGCGCCTGGCGCAGTTGACCCGCGAGTATCTGGAAGG
CAACGGCCTGCGCGTGGCCATCGAGGCCGACGGCGCTCGTGCGGCGGCGCGGATTCTCGCCGAACAGCCGGACCTGGTGA
TTCTCGACCTGATGCTGCCGGGTGAGGACGGCCTGAGCATCTGTCGCAAGGTGCGTGGCGGCTACAAGGGGCCGATCCTC
ATGCTCACCGCGCGTACCGACGACATGGACCAGGTGCTGGGTCTGGAGATGGGCGCCGATGATTACGTGTGCAAGCCAGT
ACGCCCGCGTGTGTTGCTGGCGCGCATTCGCGCGTTGCTGCGCCGCCGCGAAGGTGGCGAGAGCGAGCGCGACGAAGGCC
AGCCGCGGCGCCTGCAGTTCGGCGCGCTGGCCATCGACAGTGCGATGCGCGAAGCCTGGCTGGGCGAGCAGGGCATCGAG
CTGACCAGCGCCGAGTTCGACCTGCTGTGGCTGCTGGCGGTCAATGCCGGGCGCATCCTGTCGCGTGAGGAAATCTTCAA
TTCCCTGCGTGGCATCGAGTACGACGGCCAGGATCGCTCCATCGACGTGCGCATTTCGCGTATCCGCCCGAAGATCGGTG
ATGACCCGATGCATCCGCGCATGATCAAGACGGTGCGCAGCAAGGGCTACCTGTTCGTCGCCGAGGCCGCCGAGGCGCTG
TTGTGA

Protein sequence :
MEQEAWQILIVEDDQRLAQLTREYLEGNGLRVAIEADGARAAARILAEQPDLVILDLMLPGEDGLSICRKVRGGYKGPIL
MLTARTDDMDQVLGLEMGADDYVCKPVRPRVLLARIRALLRRREGGESERDEGQPRRLQFGALAIDSAMREAWLGEQGIE
LTSAEFDLLWLLAVNAGRILSREEIFNSLRGIEYDGQDRSIDVRISRIRPKIGDDPMHPRMIKTVRSKGYLFVAEAAEAL
L

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MDS_3430 YP_004381213.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-27 43
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 9e-25 43
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-23 43
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 9e-25 43
MDS_3430 YP_004381213.1 two component transcriptional regulator BAC0083 Protein 3e-12 42
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_008702.1.4607594. Protein 6e-26 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-24 41
MDS_3430 YP_004381213.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MDS_3430 YP_004381213.1 two component transcriptional regulator VFG1563 Protein 2e-18 41