Gene Information

Name : ykoG (CAR_c06690)
Accession : YP_004374379.1
Strain : Carnobacterium sp. 17-4
Genome accession: NC_015391
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 680480 - 681172 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
ATGAACAAAATTTTAATTATTGAAGATGAAAAAAATCTGGCTCGTTTTGTAGAACTAGAATTAAAACATGAAGGCTACGC
AACAGAGGTTCGTTACAACGGACGTACAGGATTAGAAGCTGCAGTTGCAGAAGACGCACATTGGGATGTTATTTTATTAG
ACTTAATGCTACCAGAATTAAATGGAATAGATGTTTGTCGTCGTATTAGACAAGTAAGTAATGTGCCTATTATTATGATG
ACTGCTAGAGACTCAGTTATTGACCGCGTATCTGGATTAGATCATGGTGCAGATGACTATATTGTTAAACCATTCGCTAT
TGAAGAATTACTCGCACGTTTACGCGCGTTATTCCGCCGTATTGAAATTGAAAGCGAACAAAATATCACAAAACAAACAA
CAGTTACGTATAGAGATTTAACGGTTGAAAAAGAAAACCGTGTCGTACGTCGTGGTGATGAAGTTATTGAATTAACGAAG
CGTGAATATGAATTATTGCTAGAGTTAATGGAAAATGTGAACGTTGTTTTAGCTCGTGATGTATTATTGAATAAAGTTTG
GGGATACGAAACTGAAGTTGAAACAAATGTTGTAGATGTATATATTCGTTACCTAAGAAATAAAATTGACGTTCCGAATG
TTGACAGCTACATTCAAACCGTTCGCGGGACAGGTTATGTGATGCGTTCGTGA

Protein sequence :
MNKILIIEDEKNLARFVELELKHEGYATEVRYNGRTGLEAAVAEDAHWDVILLDLMLPELNGIDVCRRIRQVSNVPIIMM
TARDSVIDRVSGLDHGADDYIVKPFAIEELLARLRALFRRIEIESEQNITKQTTVTYRDLTVEKENRVVRRGDEVIELTK
REYELLLELMENVNVVLARDVLLNKVWGYETEVETNVVDVYIRYLRNKIDVPNVDSYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_004374379.1 two-component response regulator HE999704.1.gene1528. Protein 9e-67 76
ykoG YP_004374379.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-41 52
ykoG YP_004374379.1 two-component response regulator AE015929.1.gene1106. Protein 3e-36 50
ykoG YP_004374379.1 two-component response regulator BAC0125 Protein 4e-24 43
ykoG YP_004374379.1 two-component response regulator BAC0308 Protein 4e-24 42
ykoG YP_004374379.1 two-component response regulator NC_012469.1.7685629. Protein 5e-32 42
ykoG YP_004374379.1 two-component response regulator AE000516.2.gene3505. Protein 8e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_004374379.1 two-component response regulator VFG0596 Protein 3e-24 42